DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and Six3

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_017172856.1 Gene:Six3 / 20473 MGIID:102764 Length:354 Species:Mus musculus


Alignment Length:253 Identity:175/253 - (69%)
Similarity:192/253 - (75%) Gaps:24/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKQPPSESFSPTHHQIIAPSPILAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNM 72
            |.:.|.|..|           :..:|||.||..||..||:|||::||||||.||||||||| |..
Mouse    91 GSRAPPEELS-----------MFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVA-PGA 143

  Fly    73 HEILN-CEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLG 136
            .|.:| .|::||||||||:|.||||:||.|:|||||||.|:||||||||||||.||||||||.||
Mouse   144 CEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLG 208

  Fly   137 PVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVG 201
            ||||||||||||||.||||||||||||||||||||||||||||||||:||||||:||||.|||||
Mouse   209 PVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVG 273

  Fly   202 NWFKNRRQRDRAAAAKNRIQHSQ-NSSGM------GC----RSRRADGAASPTPSDSS 248
            ||||||||||||||||||:||.. ..|||      ||    .:.....|||||.|.||
Mouse   274 NWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 86/113 (76%)
homeodomain 158..206 CDD:238039 44/47 (94%)
Six3XP_017172856.1 SIX1_SD 109..222 CDD:374862 86/113 (76%)
homeodomain 230..278 CDD:238039 44/47 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848464
Domainoid 1 1.000 175 1.000 Domainoid score I3634
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 321 1.000 Inparanoid score I2501
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002292
OrthoInspector 1 1.000 - - otm43673
orthoMCL 1 0.900 - - OOG6_105562
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2573
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.