DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and ceh-33

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_504420.1 Gene:ceh-33 / 191622 WormBaseID:WBGene00000454 Length:261 Species:Caenorhabditis elegans


Alignment Length:270 Identity:110/270 - (40%)
Similarity:152/270 - (56%) Gaps:51/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SESFSPTHHQIIAPSPILAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILN 77
            |.||.| ||        ....|..:|..||..:|:.|  |.|..:|::|:|:    :....|:.|
 Worm     5 SSSFHP-HH--------FTCDTTRYSEEQVACICEAL--SNDARKLSQFVWT----VLERDEMRN 54

  Fly    78 CEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYR 142
            .:.:|:|:|.:|:|..||:|||.|||:|.|....:..||..||.|||.||||:|||.||.|.|||
 Worm    55 NQYILKAQAFLAFHSNNFKELYRIIESHHFASEHHLPLQEWWLNAHYHEAEKIRGRQLGAVGKYR 119

  Fly   143 VRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNR 207
            :|:|:|||.||||||:.::||::::|.|||:||.::.||:|.:|||||:.|.|..|||.||||||
 Worm   120 IRRKYPLPRTIWDGEETSYCFRDKSRVLLRDWYCRNSYPSPREKRELAEKTHLTVTQVSNWFKNR 184

  Fly   208 RQRDRAAAAKNRIQHSQNSSGMGCRSRRADGAASPTPSD-----SSDSDISL--GTHSPVPSSLQ 265
            ||||||..                          |.|.|     |.:.|:.|  .|.|.:.:|. 
 Worm   185 RQRDRAGV--------------------------PEPKDCLKDISEEEDLKLIRKTASKLSNSF- 222

  Fly   266 LQHSPGSTSN 275
              |:|...|:
 Worm   223 --HNPSDLSS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 50/112 (45%)
homeodomain 158..206 CDD:238039 24/47 (51%)
ceh-33NP_504420.1 SIX1_SD 20..127 CDD:293483 50/112 (45%)
homeodomain 138..189 CDD:238039 30/50 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.