DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and ceh-32

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_505958.1 Gene:ceh-32 / 179603 WormBaseID:WBGene00000453 Length:439 Species:Caenorhabditis elegans


Alignment Length:323 Identity:155/323 - (47%)
Similarity:187/323 - (57%) Gaps:58/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SFSPTHHQIIAPSPILAVP----TLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEI 75
            |..|....:|   |.||.|    |...:|.|:...|:.||..||::.|.||:.::|.  ....|:
 Worm    45 SLFPAMPSVI---PSLAAPSSPTTSNLTADQIVKTCEQLETDGDVDGLFRFMCTIPP--QKTQEV 104

  Fly    76 LNCEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDK 140
            ...||.|||||:|.:|..:|||||||:||:||:...:.|||.||.||||.|.||.||:||..|||
 Worm   105 AGNEAFLRARALVCFHASHFRELYAILENNKFSPKYHPKLQEMWHEAHYREQEKNRGKSLCAVDK 169

  Fly   141 YRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFK 205
            ||||||:|:|.|||||||||||||||||||||||||:||||||.||:|||.||||...|||||||
 Worm   170 YRVRKKYPMPRTIWDGEQKTHCFKERTRSLLREWYLKDPYPNPPKKKELANATGLTQMQVGNWFK 234

  Fly   206 NRRQRDRAAAAKNRIQHSQNSSGMGCRSRRADGAASPTPSDSSDSDISLGTHSPVPSSLQLQHSP 270
            |||||||||||||:    ||..|:..:.         |.||.||||                   
 Worm   235 NRRQRDRAAAAKNK----QNIIGVELKK---------TSSDMSDSD------------------- 267

  Fly   271 GSTSNGANDREESLSVDD---DKPRDLSGSLPLPLSLPLPLASPTHTPPQLPPGYGGGAGAGP 330
                   :|.|:|::...   |:|:|||.|       .:|..|||..|....|.....|.|.|
 Worm   268 -------DDFEDSMTDSPSPIDEPKDLSKS-------HIPKLSPTLLPKMATPFDMFAAAANP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 58/112 (52%)
homeodomain 158..206 CDD:238039 40/47 (85%)
ceh-32NP_505958.1 SIX1_SD 68..179 CDD:293483 58/112 (52%)
homeodomain 187..236 CDD:238039 41/48 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159493
Domainoid 1 1.000 102 1.000 Domainoid score I4320
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 255 1.000 Inparanoid score I1958
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002292
OrthoInspector 1 1.000 - - oto18416
orthoMCL 1 0.900 - - OOG6_105562
Panther 1 1.100 - - LDO PTHR10390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2573
SonicParanoid 1 1.000 - - X333
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.820

Return to query results.
Submit another query.