DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and six3

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_002944388.2 Gene:six3 / 100493798 XenbaseID:XB-GENE-478761 Length:295 Species:Xenopus tropicalis


Alignment Length:230 Identity:171/230 - (74%)
Similarity:188/230 - (81%) Gaps:14/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILN-CEAVLRARAVVAYHVGNF 95
            :|:|.||..||..||:|||::||||||.||||||||| |...|.:| .|::||||||||:|.|||
 Frog    44 LPSLNFSPEQVASVCETLEETGDIERLGRFLWSLPVA-PGACEAINKHESILRARAVVAFHTGNF 107

  Fly    96 RELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKT 160
            |:||.|:|||||||.|:||||||||||||.||||||||.||||||||||||||||.|||||||||
 Frog   108 RDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKT 172

  Fly   161 HCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQH-SQ 224
            |||||||||||||||||||||||:||||||:||||.|||||||||||||||||||||||:|| |.
 Frog   173 HCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHQSI 237

  Fly   225 NSSGM------GCRSRR-----ADGAASPTPSDSS 248
            ..|||      ||.:..     :..|||||.|.||
 Frog   238 GQSGMRSLADPGCPTHSSAESPSTAAASPTTSVSS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 86/113 (76%)
homeodomain 158..206 CDD:238039 44/47 (94%)
six3XP_002944388.2 SIX1_SD 49..162 CDD:374862 86/113 (76%)
homeodomain 170..218 CDD:238039 44/47 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 175 1.000 Domainoid score I3597
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002292
OrthoInspector 1 1.000 - - otm48847
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2573
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.