DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and six2

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001093745.1 Gene:six2 / 100101784 XenbaseID:XB-GENE-481504 Length:289 Species:Xenopus tropicalis


Alignment Length:371 Identity:152/371 - (40%)
Similarity:206/371 - (55%) Gaps:106/371 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFR 96
            :||..|:..||..||:.|:..|:||||.||||||| |..::|:   .|:||:|:||||:|.||||
 Frog     4 LPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLP-ACEHLHK---NESVLKAKAVVAFHRGNFR 64

  Fly    97 ELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTH 161
            |||.|:|.|:|:..::.|||.:||:||||||||||||.||.|.|||||:|||||.:|||||:.::
 Frog    65 ELYKILEGHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSY 129

  Fly   162 CFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNS 226
            ||||::||:|||||..:|||:|.:|||||:||||..|||.|||||||||||||.||.|.:.:   
 Frog   130 CFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERYEEN--- 191

  Fly   227 SGMGCRSRRADGAASPTPSDSSDSDISLGTHSPVPSSLQLQHSPGSTSNGANDREESLSVDDDKP 291
                              :::|:|:    :|:|:.:|:    :.|.|..|        |.|||| 
 Frog   192 ------------------NENSNSN----SHNPLSTSM----NGGKTVLG--------SSDDDK- 221

  Fly   292 RDLSGSLPLPLSLPLPLASPTHTPPQLPPGYGGGAGAGPGGPLTG-PGCLPPFKLDAATSLFSAG 355
                          .|..:|.||            .:.|...|:| ||                 
 Frog   222 --------------TPSGTPDHT------------SSSPALLLSGNPG----------------- 243

  Fly   356 CYLQSFSNLKEMSQQFPIQPIVLRPHPQLPQSLALNGASGGPPLHH 401
              ||:...:.               |||.|.::.::.|.   |:||
 Frog   244 --LQALHGMS---------------HPQGPSAIPVSAAD---PMHH 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 68/112 (61%)
homeodomain 158..206 CDD:238039 30/47 (64%)
six2NP_001093745.1 SIX1_SD 9..118 CDD:374862 68/112 (61%)
homeodomain 129..180 CDD:238039 36/50 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.