DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and six6

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001093696.1 Gene:six6 / 100101705 XenbaseID:XB-GENE-483146 Length:244 Species:Xenopus tropicalis


Alignment Length:251 Identity:171/251 - (68%)
Similarity:189/251 - (75%) Gaps:14/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILN-CEAVLRARAVVAYHVGNF 95
            :|.|.||..||..||:|||:|||||||.||||||||| |...|.|| .|:||||||:||:|.|||
 Frog     4 LPILNFSPQQVAGVCETLEESGDIERLGRFLWSLPVA-PAACEALNKNESVLRARAIVAFHTGNF 67

  Fly    96 RELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKT 160
            ||||.|:|||||||.||.||||:||||||.||||||||.||||||||||||||||.|||||||||
 Frog    68 RELYHILENHKFTKDSYTKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKT 132

  Fly   161 HCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQN 225
            ||||||||.||||||||||||||:||||||:||||.|||||||||||||||||||||||:|....
 Frog   133 HCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVL 197

  Fly   226 SSGMGCRSRRADGAASPTPSDSSDSDISLGTHSPVPSSLQLQHSPGSTSNGANDRE 281
            |.|.| .|...|....|           ||:.|...:||..:.:..:.|..::|.|
 Frog   198 SQGTG-HSLGPDERGEP-----------LGSASSPAASLSSKAATSAISITSSDSE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 88/113 (78%)
homeodomain 158..206 CDD:238039 43/47 (91%)
six6NP_001093696.1 SIX1_SD 9..122 CDD:318970 88/113 (78%)
homeodomain 130..178 CDD:238039 43/47 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 175 1.000 Domainoid score I3597
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002292
OrthoInspector 1 1.000 - - otm48847
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2573
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.