DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patj and GOPC

DIOPT Version :9

Sequence 1:NP_477342.1 Gene:Patj / 44100 FlyBaseID:FBgn0067864 Length:871 Species:Drosophila melanogaster
Sequence 2:NP_065132.1 Gene:GOPC / 57120 HGNCID:17643 Length:462 Species:Homo sapiens


Alignment Length:313 Identity:72/313 - (23%)
Similarity:119/313 - (38%) Gaps:72/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DISSALQQIEAVKKGID-ESDDPKLQM------------QTAESLSTILGILQDPVFRTI----- 52
            |:.|.|.:.:|.|..:: |..|..||:            |:|:| .||...|..|....:     
Human   100 DLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADS-GTIKAKLSGPSVEELERELE 163

  Fly    53 VHVQDSLSEL------------NAQLAQHPSMLPND----------FDIDVAGNL-VLSLNGGEV 94
            .:.::.:.|.            |..|.:|.::|..:          .|.::||.: .:.|.|.::
Human   164 ANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDM 228

  Fly    95 ---MYD--FDEQRSSSHSHSAPGSPDKSGGVGEEPRP--------QSQNSKGAGVADLYATDYAQ 146
               .:|  :::..:..|.|..........|..:..||        |....|..||..:.      
Human   229 KGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIR------ 287

  Fly   147 IQAIELVNDGTGLGFGIIGARNSGV--IVKTILPGGVADKDGRLRSGDHILQIGDVNLHEMVSEQ 209
             :.:.|..|..|||..|.|.:..||  ::..|.||..||:.|.|..||.||.:..|||.:...::
Human   288 -KVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKE 351

  Fly   210 VAAVLRQSGTHVR---LVVARPVEQSVPTPQYALEPGTAVVPTRVLVDPAELE 259
            ...:|.|....:.   :.||..|:......:|..|.|...   |:.:|  |||
Human   352 AVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRY---RLYLD--ELE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatjNP_477342.1 L27 12..70 CDD:295425 16/87 (18%)
PDZ_signaling 154..226 CDD:238492 24/76 (32%)
PDZ_signaling 318..400 CDD:238492
PDZ_signaling 557..643 CDD:238492
PDZ_signaling 726..807 CDD:238492
GOPCNP_065132.1 bZIP_2 <166..199 CDD:285017 5/32 (16%)
PDZ_signaling 286..368 CDD:238492 25/88 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..449
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.