DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patj and pdzd11

DIOPT Version :9

Sequence 1:NP_477342.1 Gene:Patj / 44100 FlyBaseID:FBgn0067864 Length:871 Species:Drosophila melanogaster
Sequence 2:NP_998122.1 Gene:pdzd11 / 405893 ZFINID:ZDB-GENE-040426-2544 Length:142 Species:Danio rerio


Alignment Length:97 Identity:30/97 - (30%)
Similarity:48/97 - (49%) Gaps:11/97 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 DPNIDLEELLALPETEKLQVELKKDANG-LGITIAGYVCEKEELSGIFVKSVSPGSAADLSGRIR 363
            |.|.:|.:.  ||.|    :.|||.... ||..|.|   .|....|||:..|.|.|.|..:| ::
Zfish    37 DYNNELAQF--LPRT----IVLKKPPGAQLGFNIRG---GKASQLGIFISKVVPDSDAHRAG-LQ 91

  Fly   364 VNDRIIEVDGQSLQGYSNHQAVELLKKSGQVV 395
            ..|:::.|:....|...:.:|||:||.:.:::
Zfish    92 EGDQVLSVNEVDFQDIEHSRAVEILKTAREIL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatjNP_477342.1 L27 12..70 CDD:295425
PDZ_signaling 154..226 CDD:238492
PDZ_signaling 318..400 CDD:238492 24/79 (30%)
PDZ_signaling 557..643 CDD:238492
PDZ_signaling 726..807 CDD:238492
pdzd11NP_998122.1 PDZ_signaling 47..127 CDD:238492 26/85 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.