DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Patj and CG15617

DIOPT Version :9

Sequence 1:	NP_477342.1	Gene:	Patj / 44100	FlyBaseID:	FBgn0067864	Length:	871	Species:	Drosophila melanogaster
Sequence 2:	NP_611151.1	Gene:	CG15617 / 36871	FlyBaseID:	FBgn0034151	Length:	222	Species:	Drosophila melanogaster

Alignment Length:	53	Identity:	19/53 - (35%)
Similarity:	29/53 - (54%)	Gaps:	1/53 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   173 VKTILPGGVADKDGRLRSGDHILQIGDVNLHEMVSEQVAAVLRQSGTHVRLVV 225
            :..:.|.|:| |.|.:|.||.|.||.||...||...:...:.|::..:||:.|
  Fly    59 IVNVSPTGLA-KRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYV 110

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Patj	NP_477342.1	L27	12..70	CDD:295425
		PDZ_signaling	154..226	CDD:238492	19/53 (36%)
		PDZ_signaling	318..400	CDD:238492
		PDZ_signaling	557..643	CDD:238492
		PDZ_signaling	726..807	CDD:238492
CG15617	NP_611151.1	PDZ_signaling	30..111	CDD:238492	19/53 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900