powered by:
Protein Alignment Patj and CG15617
DIOPT Version :9
Sequence 1: | NP_477342.1 |
Gene: | Patj / 44100 |
FlyBaseID: | FBgn0067864 |
Length: | 871 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611151.1 |
Gene: | CG15617 / 36871 |
FlyBaseID: | FBgn0034151 |
Length: | 222 |
Species: | Drosophila melanogaster |
Alignment Length: | 53 |
Identity: | 19/53 - (35%) |
Similarity: | 29/53 - (54%) |
Gaps: | 1/53 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 173 VKTILPGGVADKDGRLRSGDHILQIGDVNLHEMVSEQVAAVLRQSGTHVRLVV 225
:..:.|.|:| |.|.:|.||.|.||.||...||...:...:.|::..:||:.|
Fly 59 IVNVSPTGLA-KRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYV 110
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.