DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patj and gopc

DIOPT Version :9

Sequence 1:NP_477342.1 Gene:Patj / 44100 FlyBaseID:FBgn0067864 Length:871 Species:Drosophila melanogaster
Sequence 2:NP_956851.1 Gene:gopc / 326887 ZFINID:ZDB-GENE-030131-5086 Length:455 Species:Danio rerio


Alignment Length:328 Identity:66/328 - (20%)
Similarity:123/328 - (37%) Gaps:86/328 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QQIEAVKKGIDESDDPKLQMQTA------ESLSTILGILQDPVFRTIVHVQDSLSELNAQLAQHP 70
            :::||.||  ::..:.||:.:..      |:|...:.:||..|:             .|:||   
Zfish   159 KELEASKK--EKVKEVKLEAEVKMLKKENEALRRHIAVLQAEVY-------------GARLA--- 205

  Fly    71 SMLPNDFDIDVAGNL-VLSLNGGEV-------MYDFDEQRSSSHSHSAPGSPDKSGGVGEEPRPQ 127
               ....|.::||.: .:.|.|.::       :::..|.....|.|.......:.....::|.|.
Zfish   206 ---AKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDPKKPLPS 267

  Fly   128 S--------QNSKGAGVADLYATDYAQIQAIELV-NDGTGLGFGIIGARNSGV--IVKTILPGGV 181
            .        :.::|.|          .|:.:.|. .|..|||..|.|.:..||  ::..|.|...
Zfish   268 PVGHDTDSLKKTQGVG----------PIRKVVLTKEDHEGLGISITGGKEHGVPILISEIHPTQP 322

  Fly   182 ADKDGRLRSGDHILQIGDVNLHEMVSEQVAAVLRQSGTHVR---LVVARPVEQSVPTPQY----- 238
            |::.|.|..||.||.:.::||.:...::...:|.|....:.   :.||..|:......:|     
Zfish   323 AERCGGLHVGDAILAVNNINLRDAKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDDSG 387

  Fly   239 --------ALEPGTAVVPTRVLVDPAELE---RYLI-----------STGYPEIFGESSTASTPQ 281
                    .||..:|........|||.|:   ::|:           |:..|.....|.||.:.:
Zfish   388 HRYRLYLDELEEASAANHNNGTADPASLQAVGKHLVNNRTENGDVGLSSECPSDDKTSKTAESAE 452

  Fly   282 TTT 284
            :::
Zfish   453 SSS 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatjNP_477342.1 L27 12..70 CDD:295425 14/63 (22%)
PDZ_signaling 154..226 CDD:238492 21/76 (28%)
PDZ_signaling 318..400 CDD:238492
PDZ_signaling 557..643 CDD:238492
PDZ_signaling 726..807 CDD:238492
gopcNP_956851.1 PDZ_signaling 285..367 CDD:238492 23/81 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.