DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patj and Gopc

DIOPT Version :9

Sequence 1:NP_477342.1 Gene:Patj / 44100 FlyBaseID:FBgn0067864 Length:871 Species:Drosophila melanogaster
Sequence 2:NP_001101101.2 Gene:Gopc / 309774 RGDID:1309512 Length:463 Species:Rattus norvegicus


Alignment Length:306 Identity:72/306 - (23%)
Similarity:120/306 - (39%) Gaps:64/306 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHLSADISSALQ--QIEAVKKGIDESDDPKLQMQTAESLSTILGILQDPVFRTIVHVQDSLSELN 63
            :|...|:...|:  :.|.||:...|: :.||..:..|:|...:.:||..|:             .
  Rat   153 VHSMEDLERELEANKTEKVKEARLEA-EVKLLRKENEALRRHIAVLQAEVY-------------G 203

  Fly    64 AQLAQHPSMLPNDFDIDVAGNL-VLSLNGGEV---MYD--FDEQRSSSHSH-------SAPGSPD 115
            |:||      ....|.::||.: .:.|.|.::   .:|  :::..:..|.|       :..|..|
  Rat   204 ARLA------AKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRQD 262

  Fly   116 KSGGVGEEP-RPQSQNSKGAGVADLYATDYAQIQAIELVNDGTGLGFGIIGARNSGV--IVKTIL 177
            ....:...| ..|....|..||..:.       :.:.|..|..|||..|.|.:..||  ::..|.
  Rat   263 LKRPMQAPPGHDQDSLKKSQGVGPIR-------KVLLLKEDHEGLGISITGGKEHGVPILISEIH 320

  Fly   178 PGGVADKDGRLRSGDHILQIGDVNLHEMVSEQVAAVLRQSGTHVR---LVVARPVEQSVPTPQYA 239
            ||..||:.|.|..||.:|.:..|||.:...::...:|.|....:.   :.||..|:......:|.
  Rat   321 PGQPADRCGGLHVGDAVLAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYE 385

  Fly   240 LEPGTAVVPTRVLVDPAELERYLISTGYPEIFGESSTASTPQTTTE 285
            .|.|...   |:.:|  |||.           |.:|.||...::.|
  Rat   386 DESGHRY---RLYLD--ELEG-----------GGNSGASCKDSSGE 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatjNP_477342.1 L27 12..70 CDD:295425 14/59 (24%)
PDZ_signaling 154..226 CDD:238492 23/76 (30%)
PDZ_signaling 318..400 CDD:238492
PDZ_signaling 557..643 CDD:238492
PDZ_signaling 726..807 CDD:238492
GopcNP_001101101.2 SMC_prok_B <35..>215 CDD:274008 18/81 (22%)
PDZ_signaling 287..369 CDD:238492 24/88 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.