DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patj and Stxbp4

DIOPT Version :9

Sequence 1:NP_477342.1 Gene:Patj / 44100 FlyBaseID:FBgn0067864 Length:871 Species:Drosophila melanogaster
Sequence 2:XP_006247190.1 Gene:Stxbp4 / 303443 RGDID:1307903 Length:557 Species:Rattus norvegicus


Alignment Length:166 Identity:45/166 - (27%)
Similarity:72/166 - (43%) Gaps:22/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 SRSLEPLTGLAMWSSQP--QIIELVKGDRGLGFSILDYQDPLDPND-TLIVIRSLVPGGVAQLDG 771
            :||..||      ...|  ::|.:.| :.|||..||   ..:|.|: .|:.|..:.|||....||
  Rat     8 ARSSSPL------ERDPAFRVITVAK-ETGLGLKIL---GGIDRNEGPLVYIHEVTPGGDCYKDG 62

  Fly   772 RLIPGDRLLFVNSINLENASLDQAVQALKGAS---KGVVRIGVAKPLPMTDNSLKACSNASTTSE 833
            ||.|||:|:.:|..::...|.::|...|..|.   :..:.|...:......:....|..:...||
  Rat    63 RLKPGDQLVSINKESMIGVSFEEAKNILTRAKLRWESPLEIAFIRQKSYCGHPGNICCQSPPVSE 127

  Fly   834 ETLDAQPSPPALPTVAPPA---MPPSASMGAEPDLI 866
               |.:|...|...::.||   :|.::|.....|.|
  Rat   128 ---DCEPQTSAFNLLSSPAGTLLPKTSSTPRTQDSI 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatjNP_477342.1 L27 12..70 CDD:295425
PDZ_signaling 154..226 CDD:238492
PDZ_signaling 318..400 CDD:238492
PDZ_signaling 557..643 CDD:238492
PDZ_signaling 726..807 CDD:238492 28/86 (33%)
Stxbp4XP_006247190.1 PDZ_signaling 21..94 CDD:238492 26/76 (34%)
TPR_MLP1_2 299..400 CDD:285204
GBP_C <306..389 CDD:303769
coiled coil 359..369 CDD:293879
coiled coil 378..389 CDD:293879
WW 502..531 CDD:278809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19964
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.