powered by:
Protein Alignment rasp and Y77E11A.23
DIOPT Version :9
Sequence 1: | NP_523898.1 |
Gene: | rasp / 44098 |
FlyBaseID: | FBgn0024194 |
Length: | 500 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001294504.1 |
Gene: | Y77E11A.23 / 24105244 |
WormBaseID: | WBGene00235267 |
Length: | 167 |
Species: | Caenorhabditis elegans |
Alignment Length: | 60 |
Identity: | 13/60 - (21%) |
Similarity: | 19/60 - (31%) |
Gaps: | 31/60 - (51%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 KEAKFQFPEGWSLYPFSQRRRDDSNDELENFGDFIVSFWPFYLLHVAVQGF-IRWKRPRL 100
|:.:.:||| ||:|. |:...|. .||..|:|
Worm 46 KQVRIRFPE------------------------FIISG------HIFCNGAPKRWLHPQL 75
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
rasp | NP_523898.1 |
MBOAT |
128..444 |
CDD:281107 |
|
Y77E11A.23 | NP_001294504.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D392243at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.