DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rasp and Y77E11A.23

DIOPT Version :9

Sequence 1:NP_523898.1 Gene:rasp / 44098 FlyBaseID:FBgn0024194 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001294504.1 Gene:Y77E11A.23 / 24105244 WormBaseID:WBGene00235267 Length:167 Species:Caenorhabditis elegans


Alignment Length:60 Identity:13/60 - (21%)
Similarity:19/60 - (31%) Gaps:31/60 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KEAKFQFPEGWSLYPFSQRRRDDSNDELENFGDFIVSFWPFYLLHVAVQGF-IRWKRPRL 100
            |:.:.:|||                        ||:|.      |:...|. .||..|:|
 Worm    46 KQVRIRFPE------------------------FIISG------HIFCNGAPKRWLHPQL 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
raspNP_523898.1 MBOAT 128..444 CDD:281107
Y77E11A.23NP_001294504.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D392243at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.