DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and IL1RL2

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_011510393.1 Gene:IL1RL2 / 8808 HGNCID:5999 Length:622 Species:Homo sapiens


Alignment Length:512 Identity:104/512 - (20%)
Similarity:170/512 - (33%) Gaps:166/512 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 PPSSTAVG-----VEGESLQVSLQTRANPT--PVT-----YKWTKDGTTIPQDG--DHRIFADGG 733
            |.|.||.|     ::.|.|..|.....|.|  |:|     ..|.|:.:.||...  ..||..|..
Human    42 PLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQSRIHQDET 106

  Fly   734 SLNFTRLHRDDAGIYSC--SASNSQGGATLNITVVVEY--GTTI---KSVSENI--VVNPGEDAM 789
            .:.|..:...|:|:|.|  ...:|.....:|:||..::  .|:|   .::|:..  :::.|:|..
Human   107 WILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDDS 171

  Fly   790 LSCTVE-GKPLTEEHVKWERVGYDMTVKTSTTFANGTSYLHIKDAKREDVGNFRCVADNRVDNPT 853
            |:|.:. .|......:||.:   |........|....:.|.:.:...||.||:.|.|        
Human   172 LTCHLHFPKSCVLGPIKWYK---DCNEIKGERFTVLETRLLVSNVSAEDRGNYACQA-------- 225

  Fly   854 NRDILLIVKFAPEIAK--TPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYE 916
               ||.......|:..  |.::.||..|            || .|:.|:       |.|.:.:.:
Human   226 ---ILTHSGKQYEVLNGITVSIKRAGYG------------GS-VPKIIY-------PKNHSIEVQ 267

  Fly   917 VEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRLEITSQPDPPLSLNILNVTHD 981
            :          .:|||||           |                           |:.:...:
Human   268 L----------GTTLIVD-----------C---------------------------NVTDTKDN 284

  Fly   982 TVTLAWTPGFDGGLKASYRVRYRMADREQYKYIDGLPNSHKLTIG-----GLRMNTLYLFSVMSW 1041
            |....|            ||...:.|    .|.|   .|.::..|     ..|.:.||..:: ::
Human   285 TNLRCW------------RVNNTLVD----DYYD---ESKRIREGVETHVSFREHNLYTVNI-TF 329

  Fly  1042 NELGQSSY-LPDLARAETKEA------PPPSHPASSLGGGPPTTSQTPLGGTSGMLLVGVGAGI- 1098
            .|:....| ||.:..|....|      |.|...|..:||                |:..|...: 
Human   330 LEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAYLIGG----------------LIALVAVAVS 378

  Fly  1099 VVVLLNVFVIGCCLHKRN---------EKRLKRGLELMPAELTEDSSNTPNLVIIGI 1146
            ||.:.|:|.|...|..|:         :.:|.....|.|....|...:..:.:::.|
Human   379 VVYIYNIFKIDIVLWYRSAFHSTETIVDGKLYDAYVLYPKPHKESQRHAVDALVLNI 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352 28/99 (28%)
IGc2 692..757 CDD:197706 20/75 (27%)
Ig 788..849 CDD:143165 14/61 (23%)
Ig 885..960 CDD:143165 12/74 (16%)
FN3 967..1051 CDD:238020 15/89 (17%)
IL1RL2XP_011510393.1 Ig 54..140 CDD:299845 21/85 (25%)
Ig2_IL1R_like 158..245 CDD:143234 20/100 (20%)
IG_like 171..229 CDD:214653 16/71 (23%)
TIR 413..563 CDD:279864 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.