DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and IL18RAP

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001380415.1 Gene:IL18RAP / 8807 HGNCID:5989 Length:599 Species:Homo sapiens


Alignment Length:466 Identity:88/466 - (18%)
Similarity:144/466 - (30%) Gaps:194/466 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   538 EITILANVSDNQAQYRCEASNSATEIPLFQSTTLSVHFAPETVKIRIEPEELRPGMEATIICDSS 602
            |..:..::.:.|..:.|..:                ..:|:.|     ||.| |.|         
Human    41 EFVLFCDLPEPQKSHFCHRN----------------RLSPKQV-----PEHL-PFM--------- 74

  Fly   603 SSNPPAKLSWWK---DGIPIEGINNTSKPGLWGGTVSTLEF---RVNVTQEMNGQVYTCQSANEA 661
            .||..:.:.|::   :|.|:|.|.. |.|.:.... .||.|   .||     |...|.|      
Human    75 GSNDLSDVQWYQQPSNGDPLEDIRK-SYPHIIQDK-CTLHFLTPGVN-----NSGSYIC------ 126

  Fly   662 LQRSAHEAVSLDVLYRPKFVPPPSSTA----------------------------VGVEGESLQV 698
                           |||.:..|...|                            :|..|.....
Human   127 ---------------RPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCP 176

  Fly   699 SLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDDAGIYSCSASNSQGGATLNI 763
            ||..:::.......|.|:|..:..:..:||..|       .::....|.|.|..:.|...::..:
Human   177 SLSCQSDAQSPAVTWYKNGKLLSVERSNRIVVD-------EVYDYHQGTYVCDYTQSDTVSSWTV 234

  Fly   764 TVVVEYGTTIKSVS-ENIVVNPGEDAMLSCTVE-GKPLT---EEHVKWERVGYDMTVKTSTTFAN 823
            ..||:..|.:.... :..:::|.||.:   .|| |||||   :....:||| ::..:|       
Human   235 RAVVQVRTIVGDTKLKPDILDPVEDTL---EVELGKPLTISCKARFGFERV-FNPVIK------- 288

  Fly   824 GTSYLHIKDAKRE-DVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLP 887
                .:|||:..| :|.                        .|| ||:                 
Human   289 ----WYIKDSDLEWEVS------------------------VPE-AKS----------------- 307

  Fly   888 CRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADY-GAYECVARNE 951
                                 |..|.|.|:.||.|         |::||...|. ..:.|..:|.
Human   308 ---------------------IKSTLKDEIIERNI---------ILEKVTQRDLRRKFVCFVQNS 342

  Fly   952 LGEAVETVRLE 962
            :|...::|:|:
Human   343 IGNTTQSVQLK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653 3/34 (9%)
Ig 501..560 CDD:299845 3/21 (14%)
Ig 584..666 CDD:299845 22/87 (25%)
IG_like 585..666 CDD:214653 22/86 (26%)
I-set 678..767 CDD:254352 18/116 (16%)
IGc2 692..757 CDD:197706 13/64 (20%)
Ig 788..849 CDD:143165 16/65 (25%)
Ig 885..960 CDD:143165 14/75 (19%)
FN3 967..1051 CDD:238020
IL18RAPNP_001380415.1 Ig_6 100..155 CDD:408247 15/81 (19%)
Ig 162..>221 CDD:416386 12/65 (18%)
Ig strand A 162..166 CDD:409353 0/3 (0%)
Ig strand B 171..175 CDD:409353 1/3 (33%)
Ig strand C 188..193 CDD:409353 1/4 (25%)
Ig strand C' 196..198 CDD:409353 0/1 (0%)
Ig strand E 204..209 CDD:409353 2/4 (50%)
Ig 251..354 CDD:416386 39/190 (21%)
Ig strand A 251..254 CDD:409353 0/2 (0%)
Ig strand A' 262..265 CDD:409353 1/2 (50%)
Ig strand B 267..276 CDD:409353 4/8 (50%)
Ig strand C 285..290 CDD:409353 1/15 (7%)
Ig strand D 300..308 CDD:409353 5/70 (7%)
Ig strand E 315..323 CDD:409353 4/16 (25%)
Ig strand F 334..340 CDD:409353 1/5 (20%)
Ig strand G 344..350 CDD:409353 1/5 (20%)
TIR 419..559 CDD:396246
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.