DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and cadm2a

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_005155320.1 Gene:cadm2a / 793954 ZFINID:ZDB-GENE-040426-1614 Length:442 Species:Danio rerio


Alignment Length:454 Identity:123/454 - (27%)
Similarity:189/454 - (41%) Gaps:102/454 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RQHWIKHLQ------LLRLLAVIVLASAPVPSHAQQQKFRTTP--HDLQVLEGAEAMMRCEVA-N 97
            :||.:..|.      |..:|||.|.|:......||.|    .|  .::.|.||..|.:.|.|. |
Zfish     4 KQHMLFTLYSICGIVLKDILAVSVAATKNKVRGAQGQ----VPLVQNMTVTEGGTANLTCRVEHN 64

  Fly    98 VAGAVQWTKDGFALGFSAVIPGFPRYSVL--GDRKQGIYN-------------LRISNASINDDA 147
            ...::||:.              |....|  ||:|....|             :.||..|::|:.
Zfish    65 DNTSLQWSN--------------PAQQTLFFGDKKALRDNRIELVRATSQELTISISEVSLSDEG 115

  Fly   148 DYQCQVGPARLNSAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQLKCIVANAKPAAQIV 212
            .|.|.:....:.:   |.|.|||:..|...||.|.:.    .|.|...:.|.|:.:.:||||.:.
Zfish   116 LYTCSLFTMPVKT---AKAFLTVLGVPKKPEINGLTK----PVLEGDHITLTCVTSGSKPAADVR 173

  Fly   213 WYRGNVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATVQL 277
            |::..:|.|..|..:    ::.|.||..|||:|....|||...|||:..|.||:.... ..|..|
Zfish   174 WFKNEMEVKGAKEVN----ASGKTFTVKSSLRLHVNRDDDGVAYTCRVDHVALTATHE-ETTQVL 233

  Fly   278 SVLYPPGPPYIEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKNGSQI----RMAYRTSGRLS 338
            .|.|   .||:|...:....:.||.::|.|..:|...|..::|.|:|.::    ||.  ..||  
Zfish   234 EVHY---APYVEIRQSTNVPQEGQYLKLQCVPKGNPSPDPVLWTKDGGELPDMDRMI--VDGR-- 291

  Fly   339 ENIYTFTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTEARVGDIVPLTCTT 403
              ..|||:....:...:||||:|.:..:  .||.:|.:..|||..:             |.|.:.
Zfish   292 --DLTFTSLNKTDNGTYRCEATNHLGTS--HAEFKLVIYDAPTTPS-------------PSTTSP 339

  Fly   404 APSNP----PAEIKWM----VGGR---QVRNATSKTIVSPEGGWTTTSNITAVVEPNKRSLVVI 456
            ||:.|    |.:.|.:    .|.|   :::.||...::   ||      |.|||......|:::
Zfish   340 APTLPDTTGPLDSKQLNSAVTGNRDPNELKRATDHALI---GG------IVAVVVFATLCLIIV 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 25/114 (22%)
Ig 76..155 CDD:299845 22/96 (23%)
IG_like 186..279 CDD:214653 30/92 (33%)
Ig 197..279 CDD:299845 28/81 (35%)
IG_like 296..376 CDD:214653 24/83 (29%)
Ig 300..361 CDD:299845 20/64 (31%)
Ig 380..454 CDD:299845 19/84 (23%)
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
cadm2aXP_005155320.1 Ig1_Necl-3 41..135 CDD:143325 25/110 (23%)
IG_like 45..135 CDD:214653 24/106 (23%)
IG_like 151..217 CDD:214653 25/69 (36%)
Ig 156..235 CDD:299845 28/83 (34%)
IG_like 251..325 CDD:214653 24/81 (30%)
IGc2 252..315 CDD:197706 21/68 (31%)
4.1m 395..413 CDD:128590 123/454 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10975
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.