DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and zgc:165604

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001091725.1 Gene:zgc:165604 / 792578 ZFINID:ZDB-GENE-070615-34 Length:298 Species:Danio rerio


Alignment Length:240 Identity:55/240 - (22%)
Similarity:89/240 - (37%) Gaps:53/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   763 ITVVVEYGTTIKSVSE-NIVVNPGEDAMLSCTV-------------EGKPLTEEHVKWERVGYDM 813
            :::.::||....:|.| ::.|..|:...|.|:.             ...||::.:...:.:.||.
Zfish    15 VSMFLQYGAVRVTVRESSLEVVQGDSVTLPCSFFTMMPLFRLSIIWTLTPLSDPNSPIQVIVYDQ 79

  Fly   814 TVKTSTTFANG--------------TSYLHIKDAKREDVGNFRCVADN--RVDNPTNRDILLIVK 862
            ...|......|              .:|..:.||     |.:|||..|  ...:|...::.|.|.
Zfish    80 GQVTENPSFMGRVGFAGMPWSADIILNYTRVSDA-----GVYRCVVSNPPETGDPGIGELSLTVL 139

  Fly   863 FAPEIAKTPTLLRAASGTGERGRLPC-RAQGSPKPQFIWRQ---DKKDLPINRTYKYEVEERKID 923
            ..|.:..  .|....:.||...||.| .|:|.|.||.||.:   ||..||:|           :|
Zfish   140 APPSLPM--CLWEGDTDTGGNVRLSCVVAEGFPTPQVIWEKLEPDKMTLPVN-----------MD 191

  Fly   924 SLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRLEITSQPD 968
            . ....::.:..|:....|.|.|...|.||.....:.|.:.:.||
Zfish   192 G-DMTGSVHIANVSTQSSGLYRCSVTNSLGTQHCYINLSVYTPPD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352 0/3 (0%)
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165 16/89 (18%)
Ig 885..960 CDD:143165 23/78 (29%)
FN3 967..1051 CDD:238020 2/2 (100%)
zgc:165604NP_001091725.1 IG_like 31..138 CDD:214653 20/111 (18%)
Ig 33..138 CDD:299845 20/109 (18%)
IG_like 156..230 CDD:214653 25/85 (29%)
Ig 161..225 CDD:299845 22/75 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.