Sequence 1: | NP_001036532.1 | Gene: | sns / 44097 | FlyBaseID: | FBgn0024189 | Length: | 1542 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001351438.1 | Gene: | Icam4 / 78369 | MGIID: | 1925619 | Length: | 262 | Species: | Mus musculus |
Alignment Length: | 272 | Identity: | 57/272 - (20%) |
---|---|---|---|
Similarity: | 100/272 - (36%) | Gaps: | 94/272 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 LRLLAVIVLASAPVPSHAQQQKFRTTPHDLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAV 116
Fly 117 IPG------------FPRYSVLGDR-KQG------------IYNLRISNASINDDADYQCQV--- 153
Fly 154 GPARLNSAIRANAKLTVISPPASIEIK-----GYSHNSKVEVRENQDLQLKCIVANAKPAAQIVW 213
Fly 214 YRGNVEYKPEKREDTVEESTAKRFT------TTSSLKLKPGPDDDYTEYTCQARHKALSPD-MPM 271
Fly 272 R---ATVQLSVL 280 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sns | NP_001036532.1 | I-set | 73..170 | CDD:254352 | 22/124 (18%) |
Ig | 76..155 | CDD:299845 | 18/106 (17%) | ||
IG_like | 186..279 | CDD:214653 | 23/102 (23%) | ||
Ig | 197..279 | CDD:299845 | 23/91 (25%) | ||
IG_like | 296..376 | CDD:214653 | |||
Ig | 300..361 | CDD:299845 | |||
Ig | 380..454 | CDD:299845 | |||
IG_like | 490..573 | CDD:214653 | |||
Ig | 501..560 | CDD:299845 | |||
Ig | 584..666 | CDD:299845 | |||
IG_like | 585..666 | CDD:214653 | |||
I-set | 678..767 | CDD:254352 | |||
IGc2 | 692..757 | CDD:197706 | |||
Ig | 788..849 | CDD:143165 | |||
Ig | 885..960 | CDD:143165 | |||
FN3 | 967..1051 | CDD:238020 | |||
Icam4 | NP_001351438.1 | ICAM_N | 40..123 | CDD:252248 | 20/95 (21%) |
Marek_A | <124..>167 | CDD:332932 | 10/61 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |