DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and Jam2

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001029176.1 Gene:Jam2 / 619374 RGDID:1561692 Length:298 Species:Rattus norvegicus


Alignment Length:215 Identity:58/215 - (26%)
Similarity:95/215 - (44%) Gaps:40/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 EATIICDSSSSNPPAKLSWWKDGIPIEGIN----NTSKPGLWGGTVSTLEFRV---NVTQEMNGQ 651
            ||.:.|.:......::|.|.|.|   :|::    ..:..|.:......::|.:   |||:...|:
  Rat    46 EAILACKTPKKTTSSRLEWKKLG---QGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGE 107

  Fly   652 VYTCQ--SANEALQRSAHEAVSLDVLYRPKFVPP---PSSTAVGVEGESLQVSLQTR-ANPTPVT 710
             |.|:  :..|..|....:.|.|:||..|. ||.   |:|.   :.|..:::..|.: .||.| .
  Rat   108 -YRCEVSAPTEQGQNLQEDTVMLEV
LVAPA-VPSCEVPTSV---MSGSVVELRCQEKEGNPAP-E 166

  Fly   711 YKWTKDGTTI---PQDGDHR-----IFADGGSLNFTRLHRDDAGIYSCSASNSQG-----GATLN 762
            |.|.||||::   |:.|.||     :....|:|.|..:.:.|:|.|.|.|.||.|     |..:.
  Rat   167 YIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQ 231

  Fly   763 ITVVVEYGTTIKSVSENIVV 782
            :.|:     .|..:...:||
  Rat   232 VDVL-----NISGIIAAVVV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845 18/80 (23%)
IG_like 585..666 CDD:214653 18/80 (23%)
I-set 678..767 CDD:254352 33/105 (31%)
IGc2 692..757 CDD:197706 25/73 (34%)
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
Jam2NP_001029176.1 IG_like 37..131 CDD:214653 20/88 (23%)
Ig 47..113 CDD:143165 15/69 (22%)
IG_like 143..221 CDD:214653 27/81 (33%)
IGc2 148..221 CDD:197706 25/73 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.