DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and Vsig2

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_065264.2 Gene:Vsig2 / 57276 MGIID:1928009 Length:328 Species:Mus musculus


Alignment Length:362 Identity:75/362 - (20%)
Similarity:133/362 - (36%) Gaps:95/362 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 GATLNITVVVEYGTTIKSVSENIVVNPGEDAMLSCTVE----------------GKPL------- 799
            |..:.:||          .:|.:.|..|:.|.|||:.:                |||:       
Mouse    22 GLAVEVTV----------PTEPLSVPKGKTAELSCSYKTSVGDNFALEWSFVQPGKPISASVPVL 76

  Fly   800 --TEEHVKWERVGYDMTVKTSTTFANGTSYLHIKDAKREDVGNFRCVADNRVDNPTNRDILLIVK 862
              |..|:.......|..:........|.:.|.:.|.:..|.|.:.|..:|..|..||.  |.::.
Mouse    77 YFTNGHLYPTGSKADRAILLHDPPTGGLATLKLTDLRPSDTGTYLCNVNNPPDFYTNG--LGLIN 139

  Fly   863 FAPEIAKTPTLLRAASGT--GERGRLPCR-AQGSPKPQFIWRQ--DKKDLPINRTYKYEVEERKI 922
            ....:..:..|...:..|  |....|.|| ::|:|||.:.|.:  .....|.....:.||     
Mouse   140 LTVLVPPSHPLCSQSGQTSVGGSAALGCRSSEGAPKPVYNWERLGSSPTPPPGSMVQDEV----- 199

  Fly   923 DSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRLEITSQPDPPLSLNILNVTHDTVTLAW 987
                 ...||:..::....|.|.|||.|::|.|...:.|.:|...:..::..::.|....:.|: 
Mouse   200 -----SGQLILTNLSLTSSGTYRCVASNQMGSASCELNLSVTDSSEGRVAGTLIGVLLGVLLLS- 258

  Fly   988 TPGFDGGLKASYRVRYRMADREQYKYIDGLPNSHKLTIGGLRMNTLYLFSVMSWNELGQSSYLPD 1052
                   :.|...:|::   :|:.|       ..|.|.||              ::|.:.:..|.
Mouse   259 -------VAAFCLIRFQ---KERKK-------EPKETYGG--------------SDLREDATAPG 292

  Fly  1053 L-----ARAE-TKEAPPPSHPASSLGGGPPTTSQTPL 1083
            :     .||: :||....|..||::     ||:::.|
Mouse   293 VFEQASMRADHSKELLEKSPCASTM-----TTTKSKL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352 3/8 (38%)
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165 17/85 (20%)
Ig 885..960 CDD:143165 21/77 (27%)
FN3 967..1051 CDD:238020 11/83 (13%)
Vsig2NP_065264.2 V-set 32..143 CDD:284989 24/112 (21%)
IG_like 32..142 CDD:214653 24/111 (22%)
IG_like 152..235 CDD:214653 24/92 (26%)
Ig 153..231 CDD:299845 23/87 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.