DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and BTNL2

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001291490.1 Gene:BTNL2 / 56244 HGNCID:1142 Length:482 Species:Homo sapiens


Alignment Length:511 Identity:110/511 - (21%)
Similarity:176/511 - (34%) Gaps:141/511 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 NVAGAV----------QWTKDGFALGFSAVIPGFPRYSVLGDRKQGIYNLRISNASINDDADYQC 151
            |::|||          :.::|...:|        |.:.:|              |.:.:||...|
Human     8 NLSGAVASFLFILLTMKQSEDFRVIG--------PAHPIL--------------AGVGEDALLTC 50

  Fly   152 QVGPARLNSAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQLKCIVANAKPAAQIVWYRG 216
            |:.|.|....:......:..|.|.      :.|...|||.|                .|:..|||
Human    51 QLLPKRTTMHVEVRWYRSEPSTPV------FVHRDGVEVTE----------------MQMEEYRG 93

  Fly   217 NVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATVQLSVLY 281
            .||:        :|...||   ...:||:......|..:|.|..:......:    .::.|.|..
Human    94 WVEW--------IENGIAK---GNVALKIHNIQPSDNGQYWCHFQDGNYCGE----TSLLLKVAG 143

  Fly   282 PPGPPYIEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKNGSQIRMAYRTSGRLSENIYTFTA 346
            ....|.|.....||:     .|:|:|.:||..|..|:.|.....:..:|. :..|:.:....|.|
Human   144 LGSAPSIHMEGPGES-----GVQLVCTARGWFPEPQVYWEDIRGEKLLAV-SEHRIQDKDGLFYA 202

  Fly   347 EAGDNKARFRCEASNVMSQNPLKAEVELSVLFAP-------THVTVMGPTE---ARVGDIVPLTC 401
            ||.........|:.:.:..||:..|.:.||:..|       ..:.|.||::   .|||:.:.|||
Human   203 EATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTC 267

  Fly   402 TTAP-SNPPA-EIKW----------------MVGGRQVRNATSKTIV------------------ 430
            ..:| :|..: |::|                .|.|.|:.....:|::                  
Human   268 YLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSAR 332

  Fly   431 -SPEGGWTTTSNITAVVEPNKRSLVVICHGLNMQLTENVVSTHTINVLYP--------PAPPLIS 486
             |.:|.:........|.:.....|.|:..|.:..:|   |.......:.|        |.|.:..
Human   333 PSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLIT---VEGQEDGEMQPMCSSDGWFPQPHVPW 394

  Fly   487 GYMEGQIIPAGSVQKLLCVSSGGNPLATLTWYKNDKRINSVIRAADKSVSAEITIL 542
            ..|||:.||:.| |.|...|.|...:.||....|       |.|.|.:.|..|..|
Human   395 RDMEGKTIPSSS-QALTQGSHGLFHVQTLLRVTN-------ISAVDVTCSISIPFL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 15/82 (18%)
Ig 76..155 CDD:299845 13/67 (19%)
IG_like 186..279 CDD:214653 19/92 (21%)
Ig 197..279 CDD:299845 15/81 (19%)
IG_like 296..376 CDD:214653 18/79 (23%)
Ig 300..361 CDD:299845 15/60 (25%)
Ig 380..454 CDD:299845 21/120 (18%)
IG_like 490..573 CDD:214653 18/53 (34%)
Ig 501..560 CDD:299845 12/42 (29%)
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
BTNL2NP_001291490.1 IG_like 37..141 CDD:214653 30/154 (19%)
Ig_MOG_like 43..142 CDD:143190 28/135 (21%)
Ig 148..229 CDD:299845 22/86 (26%)
IG_like 252..358 CDD:214653 18/105 (17%)
Ig_MOG_like 260..358 CDD:143190 16/97 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.