DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and cadm1b

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001107024.1 Gene:cadm1b / 562183 ZFINID:ZDB-GENE-080327-34 Length:411 Species:Danio rerio


Alignment Length:361 Identity:92/361 - (25%)
Similarity:148/361 - (40%) Gaps:107/361 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LRLLAVIVLASAPVPSHAQQQKFRTTP--------HDLQVLEGAEAMMRCEVANVAGAVQWTKDG 108
            :.|...::||:......||     |||        :::.|:||..|::.|.|.|...:|      
Zfish    20 ISLFFYVILAAFLHKGAAQ-----TTPVQGQNLVTNNVSVVEGETAIISCRVKNNDDSV------ 73

  Fly   109 FALGFSAVIPGFPRYSVLGDRKQGIY--NLR--------------------ISNASINDDADYQC 151
                          ..:|...:|.||  ::|                    :||.|::|:..|.|
Zfish    74 --------------IQLLNPNRQTIYFRDVRPLKDSRFQLVNFSDNELLVSLSNVSLSDEGRYVC 124

  Fly   152 QV--GPARLNSAIRANAKLTVISPPASIEIKGYSHNSKVE-VRENQDLQLKCIVANAKPAAQIVW 213
            |:  .|.:     .|.|.:||:.||.:..::     |:.| |.|..:.::.|....:|||:.|.|
Zfish   125 QLYTDPPQ-----EAYADITVLVPPGNPILE-----SREEIVSEGNETEITCTAMGSKPASTIKW 179

  Fly   214 YRGNVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATVQLS 278
            .:|:   :|.:.|.||||...:.||.||.|:|....:||.....|...|.|:.   ..:|...|.
Zfish   180 MKGD---QPLQGEATVEELYDRMFTVTSRLRLTVSKEDDGVAVICIIDHPAVK---DFQAQKYLE 238

  Fly   279 VLYPPGPPYIEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYK-----------NGSQIRMAYR 332
            |.|.|....:.|:..|.| |.|:.:||.|:::|...|.|:.|.|           .||.:     
Zfish   239 VQYKPEVKIVVGFPEGLT-REGENLELTCKAKGKPQPHQINWLKVDDDFPSHALVTGSDL----- 297

  Fly   333 TSGRLSENIYTFTAEAGDNKA---RFRCEASNVMSQ 365
                ..||:         ||:   .:||.|||::.:
Zfish   298 ----FIENL---------NKSYNGTYRCVASNLVGE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 26/128 (20%)
Ig 76..155 CDD:299845 23/110 (21%)
IG_like 186..279 CDD:214653 30/93 (32%)
Ig 197..279 CDD:299845 26/81 (32%)
IG_like 296..376 CDD:214653 22/84 (26%)
Ig 300..361 CDD:299845 18/74 (24%)
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
cadm1bNP_001107024.1 Ig1_Necl-2 46..140 CDD:143289 23/118 (19%)
IG_like 51..140 CDD:214653 23/113 (20%)
Ig 161..242 CDD:299845 27/86 (31%)
Ig_3 242..316 CDD:290638 23/92 (25%)
IG_like 252..329 CDD:214653 23/88 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.