DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and si:ch73-22o12.1

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_021322530.1 Gene:si:ch73-22o12.1 / 560816 ZFINID:ZDB-GENE-110411-27 Length:505 Species:Danio rerio


Alignment Length:372 Identity:83/372 - (22%)
Similarity:136/372 - (36%) Gaps:100/372 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 QKFRTTPHDLQVLEGAEAMMRCEVANVAGAVQWTK--------DGFALGFSAVIPGF----PRYS 124
            |..|..| ::....|....:||:..| .|..|.|:        |......:...|.|    |..|
Zfish    21 QHVRVEP-EVVSFPGQTVTLRCQFPN-PGDTQLTQVSWIFERTDTERTNIAVFHPNFGVNYPTTS 83

  Fly   125 VLGDRKQGIYN--------LRISNASINDDADYQCQVG--PARLNSAIRANAKLTVISPPASIEI 179
            .:..|...:.|        ::|.:..:.|:..|.|:..  |:.....:   :.|.:::.|     
Zfish    84 PVSGRVTFVSNPPTLDNPSIQIKDVKMTDEGRYICEYATYPSGNEQGV---SSLVMLAKP----- 140

  Fly   180 KGYSHNSKVEVRENQDLQLKCIVANAKPAAQIVW---YRGNV--EYKPEKREDTVEESTAKRFTT 239
            |..:....|...:...:..:|..:|.:|||.|.|   ..|||  ..|.:..::||        :.
Zfish   141 KNTATTVTVSAGKTPVIVARCESSNGRPAATITWSTALNGNVTTPKKTDNPDNTV--------SI 197

  Fly   240 TSSLKLKPGPDDDYTEYTCQARHKALS-PD-MPMRATVQLSVLYPPGPPYIEGYSAGETLRRGQT 302
            .|...|.|.|:|:..:.:|...|:.:: |: .||:..|:    ||| ...|:||:  ....||||
Zfish   198 QSVYMLAPQPEDNGKDISCIVSHRTMAQPETFPMKLVVE----YPP-VVQIKGYN--NNWYRGQT 255

  Fly   303 -VELMCRSRGGNPPAQLIWYKNGSQIRMAYRT-SGRLSENIYTFTAEAGDNK-----------AR 354
             ..|.|.:.|...|..:.|           :| ||.:.|     |.:..:|:           ..
Zfish   256 SAHLTCHADGNPVPTTVTW-----------KTLSGHMPE-----TVQVRENRLAVQQVDDTINTT 304

  Fly   355 FRCEASNVMSQNPLKAEVELSVLFAPTHVTVM----GPTEARVGDIV 397
            |.||..|             |:.:....|||:    .|..:..|.||
Zfish   305 FICEVKN-------------SLGYGRDQVTVVVREQAPPNSNAGVIV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 22/118 (19%)
Ig 76..155 CDD:299845 19/100 (19%)
IG_like 186..279 CDD:214653 25/99 (25%)
Ig 197..279 CDD:299845 24/88 (27%)
IG_like 296..376 CDD:214653 19/92 (21%)
Ig 300..361 CDD:299845 17/73 (23%)
Ig 380..454 CDD:299845 7/22 (32%)
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
si:ch73-22o12.1XP_021322530.1 Ig1_PVR_like 35..137 CDD:319295 19/105 (18%)
Ig2_Nectin-2_like 140..235 CDD:319328 26/107 (24%)
Ig 257..314 CDD:325142 16/85 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.