DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and SIRPG

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_061026.2 Gene:SIRPG / 55423 HGNCID:15757 Length:387 Species:Homo sapiens


Alignment Length:372 Identity:80/372 - (21%)
Similarity:146/372 - (39%) Gaps:77/372 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 EVRENQDLQ-----------------LKCIVANAKPAAQIVWYRG-----NVEYKPEK----RED 227
            ||...::||                 |.|.|.:..|...::|:||     .:.|..::    |..
Human    25 EVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVT 89

  Fly   228 TVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRA--TVQLSVLYPPGPPYIEG 290
            ||.:.| ||.....|:::......|...|.|....|....::..::  ..::::...|..|.:.|
Human    90 TVSDLT-KRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLG 153

  Fly   291 YSAGETLRRGQTVELMCRSRGGNP-PAQLIWYKNGSQI------------RMAY--RTSGRLSEN 340
            .:|..|..  .||...|.|.|.:| ...|.|:|||:::            .:||  |::.|:   
Human   154 PAARTTPE--HTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQSVAYSIRSTARV--- 213

  Fly   341 IYTFTAEAGDNKARFRCEASNVMSQ-NPLKAEVELS--VLFAPTHVTVMGPTEARVGDIVPLTCT 402
                ..:..|.:::..||.::|..| :||:....||  :...||......|  .|||:.|.:||.
Human   214 ----VLDPWDVRSQVICEVAHVTLQGDPLRGTANLSEAIRVPPTLEVTQQP--MRVGNQVNVTCQ 272

  Fly   403 TAPSNPPA-EIKWMVGGRQVRNATSKTIV-SPEGGWTTTSNITAVVEPNKRSLVVIC---HGLNM 462
            .....|.: ::.|...|...:..|:.|:. :.:|.:..||.....:...:..:|:.|   |...:
Human   273 VRKFYPQSLQLTWSENGNVCQRETASTLTENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQL 337

  Fly   463 QLTENV---VSTHTINVLYPPAPPLISGYMEGQIIPAGSVQKLLCVS 506
            .:::.:   |:.|..:......|.           ||.|:..||.::
Human   338 AVSKRLALEVTVHQKDQSSDATPG-----------PASSLTALLLIA 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653 23/117 (20%)
Ig 197..279 CDD:299845 20/109 (18%)
IG_like 296..376 CDD:214653 25/97 (26%)
Ig 300..361 CDD:299845 18/75 (24%)
Ig 380..454 CDD:299845 17/75 (23%)
IG_like 490..573 CDD:214653 5/17 (29%)
Ig 501..560 CDD:299845 2/6 (33%)
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
SIRPGNP_061026.2 IgV_SIRP 33..143 CDD:319346 20/110 (18%)
IgC_SIRP_domain_2 145..248 CDD:319314 29/111 (26%)
IgC_SIRP_domain_3 250..353 CDD:319334 22/104 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.