DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and KIRREL1

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:590 Identity:164/590 - (27%)
Similarity:242/590 - (41%) Gaps:136/590 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LAVIVLASAPVPSHAQQQKFRTTPHDLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAVIPG 119
            |.|.:|..:...|...|.:|...|.|..|:.|..|::.|.:.|.:|.|||||||.|||....:..
Human     4 LLVWILTLSDTFSQGTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKA 68

  Fly   120 FPRYSVLGDRKQGIYNLRISNASINDDADYQCQVGPARLNSAIRANAKLTVISPPASIEIKGYSH 184
            :|||.|:|....|.|||.|::|.::|||.|:||...|.|.|   ..|||||:.||....|.|   
Human    69 WPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRS---RRAKLTVLIPPEDTRIDG--- 127

  Fly   185 NSKVEVRENQDLQLKCIVANAKPAAQIVWYRGNVEYKPEKREDTVEES----TAKRFTTTSSLKL 245
            ...:.::......|.|...||||||.|:|:|...:     :|..|..:    ..||.||.|.|.:
Human   128 GPVILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQ-----QEGAVASTELLKDGKRETTVSQLLI 187

  Fly   246 KPGPDDDYTEYTCQARHKALSPDMPMRATVQLSVLYPPGPPY-IEGYSAGETLRRGQTVELMCRS 309
            .|...|....:||::.::|:...  ...:::|.|.:||.... ||    .:|::.|:.|...|::
Human   188 NPTDLDIGRVFTCRSMNEAIPSG--KETSIELDVHHPPTVTLSIE----PQTVQEGERVVFTCQA 246

  Fly   310 RGGNPPAQLI---WYKNGSQIRMAYRTSGRLSENI-YTFTAEAGDNKARFRCEASNVMSQNPLKA 370
            . .||  :::   |.|.|..|..|:.:  |...|: |:|..|.      ..||..|.:....:..
Human   247 T-ANP--EILGYRWAKGGFLIEDAHES--RYETNVDYSFFTEP------VSCEVHNKVGSTNVST 300

  Fly   371 EVELSVLFAPTHVTVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVGGRQVRNATSKTIVSPEGG 435
            .|  :|.|||..|....||...:|..|.|||... .|||..:.|.   ::..|...:...||   
Human   301 LV--NVHFAPRIVVDPKPTTTDIGSDVTLTCVWV-GNPPLTLTWT---KKDSNMGPRPPGSP--- 356

  Fly   436 WTTTSNITAVVEPNKRSLVVICHGLNMQLTENVVSTHTINV-------------LYPPAPPLIS- 486
              ..:.::|.|..|...|::      ..:|:....|:|...             ||...||:|| 
Human   357 --PEAALSAQVLSNSNQLLL------KSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISS 413

  Fly   487 -----------GYME---GQIIP--------------AGSVQKLLC--VSSGGNPLATLTWYKND 521
                       |.:|   |...|              .|::::...  .:||...|:|||     
Human   414 EAVQYAVRGDGGKVECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLT----- 473

  Fly   522 KRINSVIRAADKSVSAEITILANVSDNQAQYRCEASNSATEIPLFQSTTLSVHFAPETVKIRIEP 586
              ||:|:.|                |.|..|.|.|.||               |.|.|..|::|.
Human   474 --INNVMEA----------------DFQTHYNCTAWNS---------------FGPGTAIIQLEE 505

  Fly   587 EELRP 591
            .|:.|
Human   506 REVLP 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 42/96 (44%)
Ig 76..155 CDD:299845 35/78 (45%)
IG_like 186..279 CDD:214653 25/96 (26%)
Ig 197..279 CDD:299845 25/85 (29%)
IG_like 296..376 CDD:214653 20/83 (24%)
Ig 300..361 CDD:299845 17/64 (27%)
Ig 380..454 CDD:299845 19/73 (26%)
IG_like 490..573 CDD:214653 21/101 (21%)
Ig 501..560 CDD:299845 16/60 (27%)
Ig 584..666 CDD:299845 3/8 (38%)
IG_like 585..666 CDD:214653 3/7 (43%)
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 42/96 (44%)
Ig 25..116 CDD:299845 41/93 (44%)
Ig2_KIRREL3-like 138..219 CDD:143236 25/87 (29%)
I-set 223..304 CDD:254352 23/97 (24%)
Ig_2 227..305 CDD:290606 22/94 (23%)
Ig_2 311..405 CDD:290606 23/108 (21%)
IG_like 314..405 CDD:214653 22/105 (21%)
Ig5_KIRREL3 407..504 CDD:143306 30/134 (22%)
IG_like 416..504 CDD:214653 26/125 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D141865at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.