Sequence 1: | NP_001036532.1 | Gene: | sns / 44097 | FlyBaseID: | FBgn0024189 | Length: | 1542 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013337.1 | Gene: | zgc:113337 / 503741 | ZFINID: | ZDB-GENE-050306-20 | Length: | 371 | Species: | Danio rerio |
Alignment Length: | 314 | Identity: | 59/314 - (18%) |
---|---|---|---|
Similarity: | 106/314 - (33%) | Gaps: | 95/314 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 680 FVPPP---SSTAVGVEGESL-QVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFA----DGGSLN 736
Fly 737 FTRLHRDDAGIYSC-------SASNSQGGATLNITVVVEYGTTIKSVSENIVVNPGEDAMLSCTV 794
Fly 795 EGKPLTEEHVKWERVGYDMTVKTSTTFANGTSYLHIKDAKREDVGNFRCVADNRVDNPTNRDILL 859
Fly 860 IVKFAPEIAKT----------------------PTLLRAASGTGERGRLP--------------- 887
Fly 888 --CRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERK-----IDSLTYESTLIVD 934 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sns | NP_001036532.1 | I-set | 73..170 | CDD:254352 | |
Ig | 76..155 | CDD:299845 | |||
IG_like | 186..279 | CDD:214653 | |||
Ig | 197..279 | CDD:299845 | |||
IG_like | 296..376 | CDD:214653 | |||
Ig | 300..361 | CDD:299845 | |||
Ig | 380..454 | CDD:299845 | |||
IG_like | 490..573 | CDD:214653 | |||
Ig | 501..560 | CDD:299845 | |||
Ig | 584..666 | CDD:299845 | |||
IG_like | 585..666 | CDD:214653 | |||
I-set | 678..767 | CDD:254352 | 26/101 (26%) | ||
IGc2 | 692..757 | CDD:197706 | 16/76 (21%) | ||
Ig | 788..849 | CDD:143165 | 9/60 (15%) | ||
Ig | 885..960 | CDD:143165 | 15/72 (21%) | ||
FN3 | 967..1051 | CDD:238020 | |||
zgc:113337 | NP_001013337.1 | IG_like | 12..112 | CDD:214653 | 23/95 (24%) |
Ig | 21..112 | CDD:299845 | 21/92 (23%) | ||
IG_like | 120..222 | CDD:214653 | 17/135 (13%) | ||
Ig1_MRC-OX-2_like | 127..223 | CDD:143254 | 15/120 (13%) | ||
Ig | <250..316 | CDD:299845 | 11/46 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |