DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and clmp

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001008177.1 Gene:clmp / 493539 XenbaseID:XB-GENE-973667 Length:332 Species:Xenopus tropicalis


Alignment Length:209 Identity:52/209 - (24%)
Similarity:83/209 - (39%) Gaps:49/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   617 IPIEGINNTSKPG------LWGGTVSTLEFRVN----VTQEMNGQV--------------YTCQS 657
            :.||.::|.|..|      ..||.|...|....    |::.:.|..              |.|:.
 Frog    47 LDIEWLSNISDHGKQVLLSYSGGQVYNAENHKGRYSFVSKYLEGDASLFIRSLQPSDAGQYICKV 111

  Fly   658 ANEALQRSAHEAVSLDVLYRPKFVPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWT----KDGT 718
            .|....:.:.  :::.||.:|..: ..||....:||:::.::.::.|...|:.|:|.    ||..
 Frog   112 KNAGQYQWSF--ITVIVL
VKPSEL-ACSSEGAQLEGKNVTLNCKSTAGTKPLNYRWVRVNLKDNV 173

  Fly   719 TIPQDGDHRIFADGGSLNFTRLH---RDDAGIYSCSASNSQGGATLNITVVVEYGTTIKSVSENI 780
            ..|.....||    |..|...||   :.|.|.|.|..||..|..|.::.|      |::|||   
 Frog   174 ERPVQSTARI----GPENQLLLHNLSKTDNGSYRCEVSNEVGKRTCDVDV------TVQSVS--- 225

  Fly   781 VVNPGEDAMLSCTV 794
              |.|..|.::|.|
 Frog   226 --NTGILAGVACGV 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845 14/72 (19%)
IG_like 585..666 CDD:214653 14/72 (19%)
I-set 678..767 CDD:254352 27/95 (28%)
IGc2 692..757 CDD:197706 21/71 (30%)
Ig 788..849 CDD:143165 3/7 (43%)
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
clmpNP_001008177.1 V-set 29..127 CDD:369466 14/81 (17%)
Ig_3 136..208 CDD:372822 21/75 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.