DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and AgaP_AGAP012716

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_001230517.1 Gene:AgaP_AGAP012716 / 4397681 VectorBaseID:AGAP012716 Length:166 Species:Anopheles gambiae


Alignment Length:153 Identity:82/153 - (53%)
Similarity:106/153 - (69%) Gaps:3/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   619 IEGINNTSKPGLWGGTVSTLEFRVNVTQEMNGQVYTCQSANEALQRSAHEAVSLDVLYRPKFVPP 683
            |.|.||:||.||||||||:||.::|:||:|:|.||||||.||.||||.:.||:|.|||.|:|..|
Mosquito    12 IAGTNNSSKAGLWGGTVSSLELKLNITQDMDGHVYTCQSTNEMLQRSINVAVNLPVLYEPRFQTP 76

  Fly   684 PSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGTTIP---QDGDHRIFADGGSLNFTRLHRDDA 745
            ..:...||.||.|.|:|....||:.:.|.|||:|.||.   ..|:.||.::|..||.|:|.|.||
Mosquito    77 AETVVHGVAGEPLTVALVATGNPSSIAYTWTKNGQTIASTGSSGEPRIVSEGPILNITKLERTDA 141

  Fly   746 GIYSCSASNSQGGATLNITVVVE 768
            |:|:|.|.||||.|.:|||:.|:
Mosquito   142 GVYTCEAVNSQGSAMINITLQVK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845 32/46 (70%)
IG_like 585..666 CDD:214653 32/46 (70%)
I-set 678..767 CDD:254352 42/91 (46%)
IGc2 692..757 CDD:197706 31/67 (46%)
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
AgaP_AGAP012716XP_001230517.1 I-set 71..163 CDD:254352 42/91 (46%)
Ig 86..163 CDD:299845 37/76 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D141865at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.