DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and DIP-gamma

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:307 Identity:85/307 - (27%)
Similarity:122/307 - (39%) Gaps:71/307 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   735 LNFTRLHRDDAGIYSCSASNS----QGGATLNITVVVEYGTTIKSVSENIVVNPGEDAMLSCTVE 795
            |..::|...|.|.|.|..:.|    |.|.   |.|.|......:..|.::.|..||||.|:|...
  Fly   106 LKISKLRESDRGCYMCQINTSPMKKQVGC---IDVQV
PPDIINEESSADLAVQEGEDATLTCKAT 167

  Fly   796 GKPLTEEHVKWERVGYDM----------TVKTSTTFANGTSYLHIKDAKREDVGNFRCVADNRVD 850
            |.|  :..|.|.|...:|          .:|..:  .||:| |.:...:|..:|.:.|:|.|.|.
  Fly   168 GNP--QPRVTWRREDGEMILIRKPGSRELMKVES--YNGSS-LRLLRLERRQMGAYLCIASNDVP 227

  Fly   851 NPTNRDILLIVKFAPEIAKTPTLLRAASGT--GERGRLPCRAQGSPKPQFIWRQDKK-------- 905
            ...::.:.|.|:|||.:.....||    ||  |...:|.|:.:.||.|...|.:..:        
  Fly   228 PAVSKRVSLSVQFAPMVRAPSQLL----GTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASV 288

  Fly   906 ----------------DLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGE 954
                            |.|     ||.:.||: |.......|:|...:|:|.|.|.||:.|.||.
  Fly   289 STASLESGSPGPEMLLDGP-----KYGITERR-DGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGR 347

  Fly   955 AVETVRL-EITSQPDPPLSLNILNVTHDTVTLAWTPGFDGGLKASYR 1000
            |..|:|| ||...|....|    |..|        ..:.|||:.:.|
  Fly   348 AEGTLRLYEIKLHPGASAS----NDDH--------LNYIGGLEEAAR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352 11/35 (31%)
IGc2 692..757 CDD:197706 7/25 (28%)
Ig 788..849 CDD:143165 19/70 (27%)
Ig 885..960 CDD:143165 26/98 (27%)
FN3 967..1051 CDD:238020 8/34 (24%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 11/35 (31%)
Ig 47..129 CDD:299845 7/22 (32%)
Ig 140..238 CDD:299845 26/102 (25%)
IG_like 247..355 CDD:214653 32/117 (27%)
Ig 256..351 CDD:299845 26/100 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.