DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and dpr13

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:477 Identity:99/477 - (20%)
Similarity:146/477 - (30%) Gaps:199/477 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 SPEGGWTTTSNITA-VVEPNKRSLVVICHGLNMQLTENVVSTHTINVLYPPAPPLISGYMEGQII 494
            ||.||.|..:.:|. ..||:.|           .:.:|::               :|...||:.:
  Fly    45 SPGGGKTVAATMTTPASEPSVR-----------HINQNLI---------------MSQSKEGEPV 83

  Fly   495 PAGSVQKLLCVSSGGNPLATLTWYKNDKRINSVIRAADKSVSAEITILANVSDNQAQ-------- 551
            |..........|:||                |.|.:.|.:         ||.|.|:|        
  Fly    84 PVPQPYAQSAASAGG----------------SSITSFDST---------NVIDGQSQPTPTHLQE 123

  Fly   552 --------YRCEASNSATEIPLFQSTTLSVHFAPETVKIRIEPEE-LRPGMEATIICDSSSSNPP 607
                    .|.:|.::|...|      :.|| .||.|:..:|... :..|||:..          
  Fly   124 AVLQTHSHSRIQAKDTAGPYP------IPVH-RPEPVENHLEANNGIEGGMESLF---------- 171

  Fly   608 AKLSWWKDGIPIEGINNTSKPGLWGGTVSTLEFRVNVTQEMNGQVYTCQSANEALQRSAHEAVSL 672
                    |.|           ::.||             .|..|.|.|     :..:||     
  Fly   172 --------GTP-----------MYFGT-------------ENSTVVTTQ-----IGATAH----- 194

  Fly   673 DVLYRPKFVPPPSSTAVGVEG----------ESLQVSLQTRANP---TPVTYKWTKDGTTIPQDG 724
                     .|.:...:| ||          ..|.|.|.|.::.   :....|.::|.|.     
  Fly   195 ---------VPCTVHHIG-EGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTL----- 244

  Fly   725 DHRIFADGGSLNFTRLHRDDAGIYSCSASNSQGGATLNITVVVE-----YGTTIKSVSENIVVNP 784
                     .:.|.:|.  |||:|.|..|.....:......|||     .|..|:      .:.|
  Fly   245 ---------QIKFVQLR--DAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPIR------YLTP 292

  Fly   785 GEDAMLSCTVEGKPLTEEHVKW----ERVGYD----MTVKTSTTFANGTSYLHIKDAKREDVGNF 841
            |....|.|.|.......|::.|    ..:.||    :.|.|...|.  :|.|.|:..:||..|||
  Fly   293 GSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQ--SSELTIQRTRREHSGNF 355

  Fly   842 RCVADN-----------RVDNP 852
            .|||.|           :.|||
  Fly   356 TCVASNTQPASVLVHIFKGDNP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845 9/23 (39%)
IG_like 490..573 CDD:214653 18/98 (18%)
Ig 501..560 CDD:299845 13/74 (18%)
Ig 584..666 CDD:299845 12/82 (15%)
IG_like 585..666 CDD:214653 12/81 (15%)
I-set 678..767 CDD:254352 19/101 (19%)
IGc2 692..757 CDD:197706 17/77 (22%)
Ig 788..849 CDD:143165 22/79 (28%)
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
dpr13NP_001033956.2 V-set 180..276 CDD:284989 25/131 (19%)
IG_like 182..262 CDD:214653 23/115 (20%)
IG_like 285..362 CDD:214653 24/84 (29%)
IGc2 292..361 CDD:197706 23/70 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.