DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and IL1R1

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_000868.1 Gene:IL1R1 / 3554 HGNCID:5993 Length:569 Species:Homo sapiens


Alignment Length:555 Identity:98/555 - (17%)
Similarity:185/555 - (33%) Gaps:183/555 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 QKLLCVSSGG---------NP---LATLTWYKNDKRINSVIRAADKSVSAEIT------------ 540
            :|::.|||..         ||   ..|:||||:|.:         ..||.|..            
Human    28 EKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSK---------TPVSTEQASRIHQHKEKLWF 83

  Fly   541 ILANVSDNQAQYRCEASNSATEIPLFQSTTLSVHFAPETVKI-----RIEPEELRPGMEATIICD 600
            :.|.|.|: ..|.|...||:..:.:    .:|..|......:     .|..::|....:..::|.
Human    84 VPAKVEDS-GHYYCVVRNSSYCLRI----KISAKF
VENEPNLCYNAQAIFKQKLPVAGDGGLVCP 143

  Fly   601 -----SSSSNPPAKLSWWKDGIPIEGINNTSKPGLWGGTVSTLEFRVNVTQEMNGQVYTCQSANE 660
                 .:.:|...||.|:||..|:. ::|....|     |......:||.::..|. |||.::..
Human   144 YMEFFKNENNELPKLQWYKDCKPLL-LDNIHFSG-----VKDRLIVMNVAEKHRGN-YTCHASYT 201

  Fly   661 ALQRS-----AHEAVSLD--VLYRPKFVPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGT 718
            .|.:.     ..|.::|:  ...||..|.|.:.|.....|..:|:........:.:.| |..:|:
Human   202 YLGKQYPITRVIEFITLE
ENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAY-WKWNGS 265

  Fly   719 TIPQD----GDHRIFADGGS----------LNFTRLH-RDDAGIYSCSASNSQG----------- 757
            .|.:|    |:.....:..:          ||.:.:. |.....::|.|.|:.|           
Human   266 VIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYP 330

  Fly   758 ---------GATLNITVVVEYGTTIKSVSENIVV-----------------------------NP 784
                     |..:.:||::.....|..:.:..:|                             ..
Human   331 VTNFQKHMIGICVTLTVIIVCSVFIYKIFKIDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTV 395

  Fly   785 GEDAMLSCTV--------------------------EGKPLTE---EHVKWERVGYDMTVKTSTT 820
            ||.:...|.:                          .|:.:.|   |:||..|....:.|:.::.
Human   396 GEGSTSDCDIFVFKVLPEVLEKQCGYKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSG 460

  Fly   821 FA--NGTSYLHIKDAKREDVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTPTLLR-------A 876
            |:  .|:|        .|.:..:..:..:.:     :.:||.::...:..|.|..::       |
Human   461 FSWLGGSS--------EEQIAMYNALVQDGI-----KVVLLELEKIQDYEKMPESIKFIKQKHGA 512

  Fly   877 ASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINR 911
            ...:|:..:.|    .|.|.:| |:..:..:|:.|
Human   513 IRWSGDFTQGP----QSAKTRF-WKNVRYHMPVQR 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653 22/96 (23%)
Ig 501..560 CDD:299845 21/82 (26%)
Ig 584..666 CDD:299845 20/91 (22%)
IG_like 585..666 CDD:214653 19/90 (21%)
I-set 678..767 CDD:254352 22/123 (18%)
IGc2 692..757 CDD:197706 14/79 (18%)
Ig 788..849 CDD:143165 12/91 (13%)
Ig 885..960 CDD:143165 7/27 (26%)
FN3 967..1051 CDD:238020
IL1R1NP_000868.1 Ig1_IL1R_like 24..113 CDD:319308 23/98 (23%)
Ig2_IL1R_like 128..219 CDD:319309 20/97 (21%)
IG 234..328 CDD:214652 16/94 (17%)
TIR 384..540 CDD:214587 25/173 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.