DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and fipi

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:427 Identity:104/427 - (24%)
Similarity:166/427 - (38%) Gaps:85/427 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   667 HEAVSLDVLYRPKFVPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFAD 731
            ||::||.         |...:.|....|||.|  |.|:....|...|......|.::...||..:
  Fly    22 HESLSLS---------PAEHSVVRYTNESLIV--QCRSPDPKVELHWKSPKGEIIREHKGRIHIE 75

  Fly   732 GGS-----LNFTRLHRDDAGIYSCSASNSQGGA--TLNITVVVEYGTTIKSVSENIVVNPGEDAM 789
            ..|     :.|..:...|.|.:||.|::   |:  :.:..::|....|....:..:.|..||.|.
  Fly    76 QTSTEQLKIVFAHIALADKGNWSCEAAD---GSLHSKSFDLIVYQKITFTENATVMTVKEGEKAT 137

  Fly   790 LSCTVEGKPLTEEHVKWERVGYDMTVKTS-----TTFANGTSYLHIKDAKREDVGNFRCVA---D 846
            :.|.|:|:|  :.:|.|...|..::...:     ...|:|   |.|....:.|.|.:.|.|   :
  Fly   138 ILCEVKGEP--QPNVTWHFNGQPISAGAADDSKFRILADG---LLINKVTQNDTGEYACRAYQVN 197

  Fly   847 NRVDNPTNRDILLIVKFAPEIAKTPTL-LRAA--SGTGERGRLPCRAQGSPKPQFIW-RQDKKDL 907
            :...:...|.:|:.::..|..:|||.: |:.|  :||   ..|.|.|...|...|.| |:..|..
  Fly   198 SIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGT---ATLMCEALAEPPANFTWYRKHNKLH 259

  Fly   908 PINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRLEITSQPDPPLS 972
            ..||.|       .|.|.:|.|:|.:..:..:.:..|.|.|||:||....|.|||...:|..|.:
  Fly   260 SNNRLY-------TIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPAN 317

  Fly   973 LNILNVTHDTVTLAWTPGFDGGLKA------------SYRVRYRM-------------ADREQYK 1012
            ..:.....:|        ||..|.|            .:|:.|..             |.|:.|.
  Fly   318 FQLRGFNSNT--------FDVVLSAPRGPPDSPMGVNGFRIEYMTEMEFKTDAGKWTNARRKDYA 374

  Fly  1013 YIDGLPNSHKLTIGGLRMNTLYLFSVMSWNELGQSSY 1049
            :.:|.    ...:..|..:|:||....|.|..|.|.:
  Fly   375 FEEGA----TFLLTNLEPDTVYLVRAASRNLAGFSDF 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352 21/95 (22%)
IGc2 692..757 CDD:197706 18/69 (26%)
Ig 788..849 CDD:143165 16/68 (24%)
Ig 885..960 CDD:143165 24/75 (32%)
FN3 967..1051 CDD:238020 21/108 (19%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 20/86 (23%)
I-set 128..202 CDD:254352 19/78 (24%)
Ig 133..>193 CDD:299845 17/64 (27%)
IG_like 228..307 CDD:214653 28/88 (32%)
Ig 235..305 CDD:143165 24/76 (32%)
FN3 312..415 CDD:238020 21/108 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.