DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and AgaP_AGAP006350

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_557013.3 Gene:AgaP_AGAP006350 / 3290147 VectorBaseID:AGAP006350 Length:319 Species:Anopheles gambiae


Alignment Length:183 Identity:44/183 - (24%)
Similarity:68/183 - (37%) Gaps:48/183 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   734 SLNFTRLHRDDAGIYSCSASNSQGGATLNITVVVEYG--TTIKSVSENIVV--NPGEDAMLSCTV 794
            :|...|..|.|..||.|..|.....:.....:|::|.  ||...:.|..:|  ..|::..|:|.|
Mosquito   107 TLKLRRTRRKDTDIYECQISTMPVKSLQLYLIV
LDYHFLTTTTQILEGTIVYGYKGQNVNLTCIV 171

  Fly   795 ----EGKPLTEEHVKW----ERVGYDMTVKTSTTFANG-TSYLHIKDAKREDVGNFRCVADNRVD 850
                :.:|   .|:.|    :.|.|:...|...:..|. |||..|:.|:.:|.||:.|       
Mosquito   172 NHNYDRRP---SHIVWYHQKDIVAYESLRKRGRSSLNSITSYHLIRSAEFDDAGNYTC------- 226

  Fly   851 NPTNRDILLIVKFAPEI-AKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQ 902
                         |||: ....|::....|..:.||           ...|||
Mosquito   227 -------------APELYPSASTIVHILDGRWDGGR-----------DVRWRQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352 8/32 (25%)
IGc2 692..757 CDD:197706 8/22 (36%)
Ig 788..849 CDD:143165 19/69 (28%)
Ig 885..960 CDD:143165 4/18 (22%)
FN3 967..1051 CDD:238020
AgaP_AGAP006350XP_557013.3 Ig 45..139 CDD:299845 8/31 (26%)
IG_like 46..126 CDD:214653 7/18 (39%)
IG_like 157..227 CDD:214653 21/92 (23%)
Ig 165..>226 CDD:143165 18/63 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.