DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and f11r.1

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001004667.1 Gene:f11r.1 / 323696 ZFINID:ZDB-GENE-030131-2416 Length:292 Species:Danio rerio


Alignment Length:255 Identity:58/255 - (22%)
Similarity:94/255 - (36%) Gaps:51/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   692 EGESLQVSLQTRANPTP-VTYKWTKD----GTTIPQDG------DHRIFADGGSLNFTRLHRDDA 745
            ||..||.|..:....|| |.:|: ||    .|.:..||      ..|:......|.|.::.|.|.
Zfish    33 EGVDLQCSYTSDFGATPRVEWKF-KDLKGSQTLVYFDGKPTGQYTGRVTMYDKGLRFNKVTRADT 96

  Fly   746 GIYSC--SASNSQGGATLNITVVVEYGTTIKSVSENIVVNPGEDAMLSC-------------TVE 795
            |.|.|  |.|...|..|:.:||:|.....:..:..::..:  .:..|:|             ..:
Zfish    97 GDYDCEVSGSGGYGENTIKLTVL
VPPAKPVSRIPSSVTTS--SNVRLTCFDPVGSPPSTYKWYKD 159

  Fly   796 GKPLTEEHVK---WERVGYDMTVKTSTTFANGTSYLHIKDAKREDVGNFRCVADNRVDNPTNRDI 857
            ..||.|:..|   ::.:.|.|.|      .||.  |......:.|.|::.|.|.|....|...|.
Zfish   160 NTPLPEDPTKFPAFKNLTYKMNV------FNGN--LEFPSVSKMDTGSYFCEASNGEGVPQRGDE 216

  Fly   858 L-----------LIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKD 906
            :           ::......:.....||.......::|.||..::...|||.::.|.:.|
Zfish   217 VKMEVRDLNVGGIVAGVIVALLAVGLLLFGLWYASKKGYLPKLSETKQKPQAVYTQPQTD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352 28/87 (32%)
IGc2 692..757 CDD:197706 24/77 (31%)
Ig 788..849 CDD:143165 17/76 (22%)
Ig 885..960 CDD:143165 7/22 (32%)
FN3 967..1051 CDD:238020
f11r.1NP_001004667.1 Ig 22..119 CDD:299845 27/86 (31%)
IG_like 25..118 CDD:214653 26/85 (31%)
IG_like 130..210 CDD:214653 17/89 (19%)
Ig 139..210 CDD:143165 17/78 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.