DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and Sirpb1a

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001002898.1 Gene:Sirpb1a / 320832 MGIID:2444824 Length:391 Species:Mus musculus


Alignment Length:392 Identity:97/392 - (24%)
Similarity:160/392 - (40%) Gaps:84/392 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 SAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQLKCIVANAKPAAQIVWYRG-------- 216
            :|:|   :|.||.|     :|.:.      |.......|.|.|.:..|...|.||||        
Mouse    26 AAVR---ELKVIQP-----VKSFF------VGAGGSATLNCTVTSLLPVGPIRWYRGVGQSRLLI 76

  Fly   217 ---NVEYKPEKREDTVEESTAKRFTTTSSLKL-KPGPDDDYTEYTCQARHKALSPDMPMRA--TV 275
               ..|:.|  |...|.:.| ||.....|::: ...|.|..|.|..:.:..:..||:.:::  ..
Mouse    77 YPFTGEHSP--RITNVSDVT-KRNNMDFSIRISNVTPADSGTYYCVKFQRGSSEPDIEIQSGGGT 138

  Fly   276 QLSVLYPPGPPYIEGYSAGETLRRGQTVELMCRSRGGNP-PAQLIWYKNGSQI------------ 327
            :|.||..|..|.:.|.:|....:  |||...|||.|..| ...|.|:|||.:|            
Mouse   139 ELLVLAKPSSPMVSGPAARAVPQ--QTVTFTCRSHGFFPRNLTLKWFKNGDEISHLETSVEPEET 201

  Fly   328 RMAYRTSGRLSENIYTFTAEAGDNKARFRCEASNV-MSQNPLKAEVELS--VLFAPTHVTVMGPT 389
            .::||.|..:.     ...|..|.:::..||..:| :.:.||:....:|  :...||......||
Mouse   202 SVSYRVSSTVQ-----VVLEPRDVRSQIICEVDHVTLDRAPLRGIAHISEFIQVPPTLEIRQQPT 261

  Fly   390 EARVGDIVPLTCTTAPSNPPA-EIKWMVGGRQVRNATSKT-IVSPEGGWTTTS----NITAVVEP 448
              .|.:::.:||......||: ::.|:..|...|.....| ||:.:|.:...|    ||:|:.| 
Mouse   262 --MVWNVINVTCQIQKFYPPSFQLTWLENGNISRREVPFTLIVNKDGTYNWISCLLVNISALEE- 323

  Fly   449 NKRSLVVICHGLNMQLTENVVSTHTINVLYPPAPPLISGYMEGQIIPAGSVQKLLCVSSGGNPLA 513
               ::||.|...:.:..| |:.|||:         |::.:...:.:....:.|:        |:|
Mouse   324 ---NMVVTCKVEHDEQAE-VIETHTV---------LVTEHQRVKELKTAGIAKI--------PVA 367

  Fly   514 TL 515
            .|
Mouse   368 VL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 3/9 (33%)
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653 25/106 (24%)
Ig 197..279 CDD:299845 24/95 (25%)
IG_like 296..376 CDD:214653 25/95 (26%)
Ig 300..361 CDD:299845 21/73 (29%)
Ig 380..454 CDD:299845 21/79 (27%)
IG_like 490..573 CDD:214653 4/26 (15%)
Ig 501..560 CDD:299845 4/15 (27%)
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
Sirpb1aNP_001002898.1 IG_like 42..119 CDD:214653 22/79 (28%)
V-set 45..143 CDD:284989 24/100 (24%)
Ig 142..252 CDD:299845 31/116 (27%)
IgC 247..341 CDD:143166 26/100 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.