DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and Sirpb2

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_038959831.1 Gene:Sirpb2 / 310213 RGDID:1309745 Length:351 Species:Rattus norvegicus


Alignment Length:271 Identity:54/271 - (19%)
Similarity:101/271 - (37%) Gaps:66/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 W--IKHLQLLRLLAVIVLASAPVPSHAQQQKFRTTPHDLQVLEGAEAMMRCEVANV--AGAVQWT 105
            |  |.|..|| |:.::.|..|.:    ::.|.......:.|.:|...::.|.|.::  .|.|:|.
  Rat     7 WANILHSALL-LILLLELKGADM----KELKVIQPQKSVSVYDGGSVILNCTVTSLIPVGPVKWF 66

  Fly   106 KDGFALGFSAVI------PGFPRYSVLGD---RKQGIYNLRISNASINDDADYQC---QVGPARL 158
            |   .:|.:.::      ..|||.:.:.|   |....:::.|||.::.|...:.|   |.|    
  Rat    67 K---GVGQNRILTYHFTGEYFPRITSVTDTNKRNNMDFSIHISNITLEDAGTFFCVKFQKG---- 124

  Fly   159 NSAIRANAKLTVISPPASI----------------EIKGYSHNSKVEVRENQDLQLKCIVANAKP 207
                       ::.|...|                |:|....:..:.|.....:.|.|.|.:..|
  Rat   125 -----------IVEPDTEIVSGGGTELFVFGADMKELKVIQPDKAISVDAGGSVILNCTVTSVIP 178

  Fly   208 AAQIVWYRGNVEYKPEKRED---------TVEESTAKRFTTTSSLKL-KPGPDDDYTEYTCQARH 262
            ...|.|:|| |::..:...:         |.....:||.....|:.: ...|.|..|.|..:.:.
  Rat   179 VGPIRWFRG-VKHSRQLIYNFIGNNFPRVTNASDASKRNNLDFSIHISNVTPADAGTYYCVKFQK 242

  Fly   263 KALSPDMPMRA 273
            ..:.||:.:::
  Rat   243 GIVEPDIEIQS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 22/110 (20%)
Ig 76..155 CDD:299845 20/92 (22%)
IG_like 186..279 CDD:214653 20/98 (20%)
Ig 197..279 CDD:299845 19/87 (22%)
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
Sirpb2XP_038959831.1 Ig 32..142 CDD:416386 24/127 (19%)
FR1 32..53 CDD:409353 3/20 (15%)
Ig strand A 32..35 CDD:409353 1/2 (50%)
Ig strand A' 39..43 CDD:409353 0/3 (0%)
Ig strand B 46..54 CDD:409353 1/7 (14%)
CDR1 54..60 CDD:409353 1/5 (20%)
FR2 61..69 CDD:409353 4/10 (40%)
Ig strand C 61..67 CDD:409353 3/5 (60%)
CDR2 70..84 CDD:409353 1/13 (8%)
Ig strand C' 73..76 CDD:409353 0/2 (0%)
Ig strand C' 82..85 CDD:409353 0/2 (0%)
FR3 85..123 CDD:409353 9/37 (24%)
Ig strand D 86..90 CDD:409353 1/3 (33%)
Ig strand E 100..106 CDD:409353 0/5 (0%)
Ig strand F 114..121 CDD:409353 1/6 (17%)
CDR3 124..129 CDD:409353 1/19 (5%)
Ig strand G 129..134 CDD:409353 1/4 (25%)
FR4 130..142 CDD:409353 1/11 (9%)
Ig strand G' 137..142 CDD:409353 0/4 (0%)
Ig 151..261 CDD:416386 21/104 (20%)
FR1 151..172 CDD:409353 3/20 (15%)
Ig strand A 151..154 CDD:409353 1/2 (50%)
Ig strand A' 158..162 CDD:409353 0/3 (0%)
Ig strand B 165..173 CDD:409353 2/7 (29%)
CDR1 173..179 CDD:409353 1/5 (20%)
FR2 180..188 CDD:409353 4/8 (50%)
Ig strand C 180..186 CDD:409353 2/5 (40%)
CDR2 189..203 CDD:409353 0/13 (0%)
Ig strand C' 192..195 CDD:409353 0/2 (0%)
Ig strand C' 201..204 CDD:409353 0/2 (0%)
FR3 204..242 CDD:409353 8/37 (22%)
Ig strand D 205..209 CDD:409353 1/3 (33%)
Ig strand E 219..225 CDD:409353 1/5 (20%)
Ig strand F 233..240 CDD:409353 2/6 (33%)
CDR3 243..248 CDD:409353 0/4 (0%)
Ig strand G 248..253 CDD:409353 1/4 (25%)
FR4 249..261 CDD:409353 0/5 (0%)
Ig strand G' 256..261 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.