DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and Btnl2

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_446267.1 Gene:Btnl2 / 309620 RGDID:620731 Length:513 Species:Rattus norvegicus


Alignment Length:534 Identity:112/534 - (20%)
Similarity:183/534 - (34%) Gaps:174/534 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 FPRYSVLGDRKQGIY---------NLRISN------ASINDDADYQCQVGPARLNSAIRANAKLT 169
            ||.||:.|.....::         :.|:..      |::.:||...|::.|.|..          
  Rat     4 FPGYSLSGVAASFLFVLLTMKHPDDFRVVGPALPILANVGEDALLTCRLLPKRTT---------- 58

  Fly   170 VISPPASIEIKGYSHNSKVEV---RENQDLQLKCIVANAKPAAQIVWYRGNVEYKPEKREDTVEE 231
                 |.:|::.|..:....|   |:..::          |...:..|||.||:    .||:.||
  Rat    59 -----ARMEVRWYRSDPDTPVMLYRDGAEV----------PGLAMEGYRGRVEW----MEDSTEE 104

  Fly   232 STAKRFTTTSSLKLK---PGPDDDYTEYTCQARHKALSPDMPMRATVQLSVLYPPGPPYIEGYSA 293
            .:.       :||::   ||.|.   :|.|:.:    ..|....|:|.|.|......|.|.....
  Rat   105 GSV-------ALKIRQVQPGDDG---QYWCRIQ----EGDYWREASVLLQVAALGSSPNIHVEGP 155

  Fly   294 GETLRRGQTVELMCRSRGGNPPAQLIWYKNGSQIRMAYRTSGRLSEN-IY----TFTAE-----A 348
            ||     :.|:|:|.|||..|..::.|.....:..|:      |||| :|    .|:.|     .
  Rat   156 GE-----EGVQLVCTSRGWFPEPEVYWEGIRGEKLMS------LSENHVYGEDGLFSVEDTLVVR 209

  Fly   349 GDNKARFRCEASNVMSQNPLKAEV----ELSVLFAPTHVTVMGPTEA---RVGDIVPLTCTTAPS 406
            .|:.....|...|...:.|.:|.:    :|....|.:.  |:||::|   |||:.:.|||..:|.
  Rat   210 NDSVETISCFIYNRGLREPQEATIALPEKLQTELASSR--VIGPSQAIPVRVGETIELTCQLSPQ 272

  Fly   407 N--PPAEIKWM------------------------VGGR---------------QVRNATSKTIV 430
            .  ...|::|:                        ..||               |:.||.:    
  Rat   273 TDAQSLEVRWLRARYYPVVHVYTNGAHEAGEQMAEYRGRTSLVTDAIHEGKLTLQIHNART---- 333

  Fly   431 SPEGGWTTTSNITAVVEPNKRSLVVICHGLNMQLTENVVSTHTINVLYPPAPPLISGYMEGQIIP 495
            |.||.:........|.:..:..:.|:..|...|:|.                         :::.
  Rat   334 SDEGQYRCLFGKDGVYQEARVDVQVMAVGSTPQITR-------------------------EVLK 373

  Fly   496 AGSVQKLLCVSSGGNPLATLTWYKNDKRINSVIRAADKSVSAEI----TILANVSDNQAQYRCEA 556
            .|..| |.|.|.|..|...:.|...|.|.......|.:..|.|:    |:|...:.:.....|..
  Rat   374 DGGTQ-LRCTSDGWFPRPHVQWRDRDGRTLPSFSEAFRQGSQELFQVETLLLVTNGSMVNVTCSI 437

  Fly   557 SNSATEIPLFQSTT 570
            |     :||.:..|
  Rat   438 S-----LPLGEEKT 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 12/64 (19%)
Ig 76..155 CDD:299845 10/49 (20%)
IG_like 186..279 CDD:214653 23/98 (23%)
Ig 197..279 CDD:299845 21/84 (25%)
IG_like 296..376 CDD:214653 22/93 (24%)
Ig 300..361 CDD:299845 18/70 (26%)
Ig 380..454 CDD:299845 22/117 (19%)
IG_like 490..573 CDD:214653 20/85 (24%)
Ig 501..560 CDD:299845 15/62 (24%)
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
Btnl2NP_446267.1 IG_like 37..141 CDD:214653 32/146 (22%)
Ig_MOG_like 43..142 CDD:143190 31/141 (22%)
Ig 152..229 CDD:299845 21/87 (24%)
IG_like 257..358 CDD:214653 18/104 (17%)
Ig_MOG_like 260..358 CDD:143190 16/101 (16%)
Ig <379..444 CDD:299845 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.