| Sequence 1: | NP_001036532.1 | Gene: | sns / 44097 | FlyBaseID: | FBgn0024189 | Length: | 1542 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038936973.1 | Gene: | Crtam / 300649 | RGDID: | 1304602 | Length: | 389 | Species: | Rattus norvegicus |
| Alignment Length: | 233 | Identity: | 49/233 - (21%) |
|---|---|---|---|
| Similarity: | 85/233 - (36%) | Gaps: | 49/233 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 188 VEVRENQDLQLKCIVANAK--------PAAQIVWYRGNVEYKPEKREDTVEESTAKRFTTTSSLK 244
Fly 245 LKPGPDDDYTEYTCQARHKALSPDMPMRATVQLSVLYPPGPPYIEGYSAGETLRR---GQTVELM 306
Fly 307 CRSRGGNPPAQLIWYKNG-----SQIRMAYRTSGRLSENIYTFTAEAGDNKARFRCEASNVMSQN 366
Fly 367 PLKAEVELSVLFAPTHVTVMGPTEARVGDIVPLTCTTA 404 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sns | NP_001036532.1 | I-set | 73..170 | CDD:254352 | |
| Ig | 76..155 | CDD:299845 | |||
| IG_like | 186..279 | CDD:214653 | 18/98 (18%) | ||
| Ig | 197..279 | CDD:299845 | 13/89 (15%) | ||
| IG_like | 296..376 | CDD:214653 | 17/87 (20%) | ||
| Ig | 300..361 | CDD:299845 | 12/65 (18%) | ||
| Ig | 380..454 | CDD:299845 | 7/25 (28%) | ||
| IG_like | 490..573 | CDD:214653 | |||
| Ig | 501..560 | CDD:299845 | |||
| Ig | 584..666 | CDD:299845 | |||
| IG_like | 585..666 | CDD:214653 | |||
| I-set | 678..767 | CDD:254352 | |||
| IGc2 | 692..757 | CDD:197706 | |||
| Ig | 788..849 | CDD:143165 | |||
| Ig | 885..960 | CDD:143165 | |||
| FN3 | 967..1051 | CDD:238020 | |||
| Crtam | XP_038936973.1 | Ig | 22..112 | CDD:416386 | 18/98 (18%) |
| FR1 | 22..37 | CDD:409353 | 6/12 (50%) | ||
| Ig strand A' | 22..28 | CDD:409353 | 2/3 (67%) | ||
| Ig strand B | 30..38 | CDD:409353 | 4/7 (57%) | ||
| CDR1 | 38..43 | CDD:409353 | 0/4 (0%) | ||
| FR2 | 44..51 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 44..50 | CDD:409353 | 0/5 (0%) | ||
| CDR2 | 52..63 | CDD:409353 | 0/10 (0%) | ||
| Ig strand C' | 54..58 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 60..63 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 64..99 | CDD:409353 | 8/40 (20%) | ||
| Ig strand D | 68..75 | CDD:409353 | 1/7 (14%) | ||
| Ig strand E | 78..84 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 91..99 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 100..103 | CDD:409353 | 0/2 (0%) | ||
| Ig strand G | 103..112 | CDD:409353 | 1/13 (8%) | ||
| FR4 | 105..112 | CDD:409353 | 1/11 (9%) | ||
| C2-set_2 | 119..205 | CDD:400489 | 19/97 (20%) | ||
| Ig strand B | 135..142 | CDD:409353 | 3/6 (50%) | ||
| Ig strand C | 147..155 | CDD:409353 | 3/7 (43%) | ||
| Ig strand C' | 157..159 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 161..168 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 173..181 | CDD:409353 | 1/7 (14%) | ||
| Ig strand F | 191..198 | CDD:409353 | 2/10 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||