DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and Icam4

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001165548.1 Gene:Icam4 / 298702 RGDID:1308971 Length:264 Species:Rattus norvegicus


Alignment Length:271 Identity:53/271 - (19%)
Similarity:91/271 - (33%) Gaps:108/271 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SAPVPSHAQQQKFRTTPHDLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAVIPGFPRYSVL 126
            :.|:|.|:   ..||     |:.:|       ::.|.:|   |..                |.:|
  Rat    64 NCPLPVHS---SLRT-----QLRQG-------KIVNGSG---WVS----------------YQLL 94

  Fly   127 GDRKQGIYNLRISNASINDDADYQCQV---GPARLNSAIRANAKLTVISPPASIEIK-----GYS 183
                    ::|..|:.:      :|.|   |..|     .|.|::|....|.|:.::     |:.
  Rat    95 --------DVRAWNSKV------RCVVTCAGETR-----EATARITAFKRPRSVILEPPVLVGHK 140

  Fly   184 HNSKVEVRENQDLQLKCIVANAKPAAQIVWYRGNVEYKPEKREDTVEESTAKRFT------TTSS 242
            :.            |:|.|.:..|...:|     |..:...|  .|...:.:|||      .|.:
  Rat   141 YT------------LRCYVTHVFPVGFLV-----VSLRKGGR--VVYHESLQRFTGSDLANVTLT 186

  Fly   243 LKLKPGPDDDYTEYTCQARHK------------------ALSPDMPMRATVQLSVL----YPPGP 285
            ..::.|.:|.:...||.||..                  ||||.....|::.::.|    ...|.
  Rat   187 YVMRAGLNDLWQPLTCHARLNLDGLVVRSSSAPVMLTVLALSPASISLASISIATLVGIFLAVGA 251

  Fly   286 PYIEGYSAGET 296
            .|:..|.|.:|
  Rat   252 VYVRKYLAVQT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 17/99 (17%)
Ig 76..155 CDD:299845 12/81 (15%)
IG_like 186..279 CDD:214653 23/116 (20%)
Ig 197..279 CDD:299845 23/105 (22%)
IG_like 296..376 CDD:214653 1/1 (100%)
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
Icam4NP_001165548.1 ICAM_N 40..123 CDD:252248 21/111 (19%)
PHA03271 <124..>167 CDD:223030 10/61 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.