DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and Igsf21

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001258383.1 Gene:Igsf21 / 298591 RGDID:1310117 Length:468 Species:Rattus norvegicus


Alignment Length:527 Identity:118/527 - (22%)
Similarity:183/527 - (34%) Gaps:158/527 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 LSVLYPPGPPYIEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKNGSQIRMAYRTSGRLSENI 341
            |:|...|.||.:          .|..|.|.|..:......:::||:        ....|.:.:.|
  Rat    26 LTVNIEPLPPVV----------AGDAVTLKCNFKTDGRMREIVWYR--------VTDGGTIKQKI 72

  Fly   342 YTFTAEAGDNKARFRCEASNVMSQNPLKAE--VELSVLFAPTHVTVMGPTEARVGDIVPLTCTTA 404
            :||.|....|.:..         :|..|.|  |..|.:..|         |.|:.|..|..|   
  Rat    73 FTFDAMFSTNYSHM---------ENYRKREDLVYQSTVRLP---------EVRISDNGPYEC--- 116

  Fly   405 PSNPPAEIKWMVGGRQVRNATSKTIVSPEGGWTTTSNITAVVEPNKRSLVVICHGLNMQLTENVV 469
                      .||                           :.:...|..||:..| |:.|  ||:
  Rat   117 ----------HVG---------------------------IYDRATREKVVLASG-NIFL--NVM 141

  Fly   470 STHT-INVLYPPAPPLISGYMEGQIIPAGSVQKLLCVSSGGNPLATLTWYKND-KRINSV-IRAA 531
            :..| |.|:...:|...|.|.....       .|:|:.|||.| |.:.::|.| :.|::| :...
  Rat   142 APPTSIEVVAADSPAPFSRYQAQNF-------TLVCIVSGGKP-APMVYFKRDGEPIDAVPLTEL 198

  Fly   532 DKSVSAEI--------TILANVSDNQAQ---------YRC------EASNSATEIP-LF-QSTTL 571
            ..|.|..:        .:..:|.|.:.|         ||.      ..|.|.|:.| || |.||.
  Rat   199 PASSSGSVQDSRPFRSLLHRDVDDTKMQKSLSLLDTEYRAGRPYTERPSRSLTQDPNLFVQPTTE 263

  Fly   572 SVHFAPETVKIRIEPEELRPGMEATIICDSSSSNPPAKLSWWKDGIPIEGINNTSKPGLWGGTVS 636
            ::   ||||..|..|.                        |.....|:..:.::..||..|    
  Rat   264 NI---PETVVSREFPR------------------------WVHSAEPVYFLRHSRTPGSDG---- 297

  Fly   637 TLEFRVNVTQEMNGQV-----YTCQSANEALQRSAHEAVSLDVLYRPKFVPPPSSTAVGVEGESL 696
            |:|.|..:|..:|.|:     ::|:..:.||.......|:|.....||.:..||...||.....|
  Rat   298 TVEVRALLTWTLNPQIDNEALFSCEVKHPALSMPMQAEVTLVAPKGPKIMMTPSRARVGDTVRIL 362

  Fly   697 QVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRD-DAGIYSCSASNSQGGAT 760
            ....|....|.|: :.||:.|:.: .||....  ||..|...|:..: :..:|.|:|.|..|...
  Rat   363 VHGFQNEVFPEPM-FTWTRVGSRL-LDGSAEF--DGKELVLERVPAELNGSMYRCTAQNPLGSTD 423

  Fly   761 LNITVVV 767
            .:..::|
  Rat   424 THTRLIV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653 1/1 (100%)
Ig 197..279 CDD:299845 1/1 (100%)
IG_like 296..376 CDD:214653 16/81 (20%)
Ig 300..361 CDD:299845 12/60 (20%)
Ig 380..454 CDD:299845 9/73 (12%)
IG_like 490..573 CDD:214653 27/109 (25%)
Ig 501..560 CDD:299845 19/83 (23%)
Ig 584..666 CDD:299845 15/86 (17%)
IG_like 585..666 CDD:214653 15/85 (18%)
I-set 678..767 CDD:254352 24/89 (27%)
IGc2 692..757 CDD:197706 17/65 (26%)
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
Igsf21NP_001258383.1 Ig 39..130 CDD:325142 26/156 (17%)
Ig 372..432 CDD:325142 17/63 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.