DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and SIGLEC9

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_006723209.1 Gene:SIGLEC9 / 27180 HGNCID:10878 Length:481 Species:Homo sapiens


Alignment Length:503 Identity:101/503 - (20%)
Similarity:159/503 - (31%) Gaps:198/503 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 IVWYRGNVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATV 275
            ::|.|           :..|..|:|..|..||:.::.|                      :...|
Human     8 LLWGR-----------ERAEGQTSKLLTMQSSVTVQEG----------------------LCVHV 39

  Fly   276 QLSVLYP------PGPPYIEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKNGSQIR------ 328
            ..|..||      || |.:.||...|.....|...:     ..|.||:.:|.:...:..      
Human    40 PCSFSYPSHGWIYPG-PVVHGYWFREGANTDQDAPV-----ATNNPARAVWEETRDRFHLLGDPH 98

  Fly   329 -----MAYRTSGRLSENIYTFTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGP 388
                 ::.|.:.|.....|.|..|.|..|..::..          :..|.::.|....::.:.|.
Human    99 TKNCTLSIRDARRSDAGRYFFRMEKGSIKWNYKHH----------RLSVNVTALTHRPNILIPGT 153

  Fly   389 TEARVGDIVPLTCT---TAPSNPPAEIKWMVGGRQVRNATSKTIVSPEGGWTTTSNI-TAVVEPN 449
            .|:  |....|||:   ......|..|.| :|          |.|||....||.|:: |.:.:|.
Human   154 LES--GCPQNLTCSVPWACEQGTPPMISW-IG----------TSVSPLDPSTTRSSVLTLIPQPQ 205

  Fly   450 KRSLVVICHGLNMQLT---ENVVSTHTI--NVLYPPAPPLISGYMEGQIIPAGSVQKLLCVSSGG 509
            .....:.|     |:|   .:|.:..|:  ||.|||                   |.|       
Human   206 DHGTSLTC-----QVTFPGASVTTNKTVHLNVSYPP-------------------QNL------- 239

  Fly   510 NPLATLTWYKNDKRINSVIRAADKSVSAEITILANVSDNQAQYRCEASNSATEIPLFQSTTLSVH 574
                |:|.::.|..::              |:|.|                       .::||: 
Human   240 ----TMTVFQGDGTVS--------------TVLGN-----------------------GSSLSL- 262

  Fly   575 FAPETVKIRIEPEELRPGMEATIIC--DSSSSNPPAKLSW-WKDGIPIEGI----NNTSKPGL-- 630
                       ||    |....::|  |:..|||||:||. |:      |:    :..|.||:  
Human   263 -----------PE----GQSLRLVCAVDAVDSNPPARLSLSWR------GLTLCPSQPSNPGVLE 306

  Fly   631 --WGGTVSTLEFRVNVTQEMNG-QVYTCQSANEALQRSAHEAVSLDVL 675
              |.......||.......:.. |||    .|.:||..|...|:..|:
Human   307 LPWVHLRDAAEFTCRAQNPLGSQQVY----LNVSLQSKATSGVTQGVV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653 10/67 (15%)
Ig 197..279 CDD:299845 10/67 (15%)
IG_like 296..376 CDD:214653 13/90 (14%)
Ig 300..361 CDD:299845 12/71 (17%)
Ig 380..454 CDD:299845 19/77 (25%)
IG_like 490..573 CDD:214653 9/82 (11%)
Ig 501..560 CDD:299845 7/58 (12%)
Ig 584..666 CDD:299845 26/93 (28%)
IG_like 585..666 CDD:214653 26/92 (28%)
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
SIGLEC9XP_006723209.1 Ig_Siglec_N 23..140 CDD:143189 27/154 (18%)
IG_like 26..>118 CDD:214653 20/119 (17%)
Ig 151..222 CDD:299845 22/88 (25%)
IG_like 258..336 CDD:214653 26/103 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.