DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and NECTIN3

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_011510965.1 Gene:NECTIN3 / 25945 HGNCID:17664 Length:580 Species:Homo sapiens


Alignment Length:393 Identity:95/393 - (24%)
Similarity:149/393 - (37%) Gaps:79/393 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PHDLQVLEGAEAMMRC--EVANVAGAVQWTKDGFALGFSA--VIPGFPRYSVLGDRKQGIYNLRI 138
            || :..:.|....::|  ||......:.|.|   ..|.|:  |....|:|   |...||.|..|:
Human    95 PH-VTAVWGKNVSLKCLIEVNETITQISWEK---IHGKSSQTVAVHHPQY---GFSVQGEYQGRV 152

  Fly   139 --SNASIN------------DDADYQCQVGPARLNSAIRANAKLTVISPPASIEIKGYSHNSKVE 189
              .|.|:|            |...|.|:.....|.:| :::..:||:..|....|||  .:|.::
Human   153 LFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNA-QSSTTVTVLVEPTVSLIKG--PDSLID 214

  Fly   190 VRENQDLQLKCIVANAKPAAQIVWYRGNVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYT 254
             ..|:.:...||.|..||.|.|.| .|::    .:.|.|......:..|..|..||.|.......
Human   215 -GGNETVAAICIAATGKPVAHIDW-EGDL----GEMESTTTSFPNETATIISQYKLFPTRFARGR 273

  Fly   255 EYTCQARHKALSPDMPMRATVQLSVLYPPGPPYIEGYSAGETL-RRGQTVELMCRSRGGNPPAQL 318
            ..||..:|.||..|  :|.:..|.:.|.| ...:.||.....: |:|  |.|.|.:....||.:.
Human   274 RITCVVKHPALEKD--IRYSFILDIQYAP-EVSVTGYDGNWFVGRKG--VNLKCNADANPPPFKS 333

  Fly   319 IWYKNGSQIRMAYRTSGRLSENIYTFTAEAGDNKARF------------RCEASNVMSQNPLKAE 371
            :|          .|..|:..:.:.     |.||...|            .|:.:|.:.|   :::
Human   334 VW----------SRLDGQWPDGLL-----ASDNTLHFVHPLTFNYSGVYICKVTNSLGQ---RSD 380

  Fly   372 VELSVLFAPTHVTVMGPT---EARVGDIVPLTCTTAPSNPPAEIKWMVGGRQVRNATSKTIV-SP 432
            .::..:..|...|.:.||   .....||..|  .|.|...|..:..:.   .:::.|..||: |.
Human   381 QKVIYISDPPTTTTLQPTIQWHPSTADIEDL--ATEPKKLPFPLSTLA---TIKDDTIATIIASV 440

  Fly   433 EGG 435
            .||
Human   441 VGG 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 26/109 (24%)
Ig 76..155 CDD:299845 24/94 (26%)
IG_like 186..279 CDD:214653 26/92 (28%)
Ig 197..279 CDD:299845 24/81 (30%)
IG_like 296..376 CDD:214653 17/92 (18%)
Ig 300..361 CDD:299845 14/72 (19%)
Ig 380..454 CDD:299845 16/60 (27%)
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
NECTIN3XP_011510965.1 IG_like 95..197 CDD:214653 26/109 (24%)
Ig1_Nectin-3_like 103..198 CDD:143295 24/101 (24%)
Ig 201..296 CDD:299845 30/104 (29%)
IG_like 318..379 CDD:214653 15/78 (19%)
Ig_3 <318..373 CDD:290638 13/69 (19%)
TM_EGFR-like 435..463 CDD:213052 5/9 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.