DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and CG30350

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:127 Identity:27/127 - (21%)
Similarity:56/127 - (44%) Gaps:25/127 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1129 AELTEDSSNTPNLVIIGISLAA--------FGFLLVNASLVAWFFVHQRRKKVAETTNQPAKTAT 1185
            |:|||....|..|.:.....||        .|.|:|| .:..|   ||.|:::      ....:|
  Fly    16 AQLTEQERLTAQLKVKERKKAAKAKPKKILGGLLMVN-HMKMW---HQHRERI------KGAIST 70

  Fly  1186 IEMYAPSSYNDTVTGETLSSVSEKSESYSNEGSSQPEYIDEVRKKAASTYLVEGSDMPPPRY 1247
            ::..||:.....:||  ::::.::::::.....:..:.:.|:.:    |....|: :.|.||
  Fly    71 VDAEAPNFQAARITG--VNNLRDEAQTFMKRTKANIQLLVEISR----TMRTHGA-INPFRY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 12/79 (15%)
cyclophilin 212..369 CDD:294131
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.