| Sequence 1: | NP_001036532.1 | Gene: | sns / 44097 | FlyBaseID: | FBgn0024189 | Length: | 1542 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006248387.2 | Gene: | Cd200 / 24560 | RGDID: | 3104 | Length: | 310 | Species: | Rattus norvegicus |
| Alignment Length: | 225 | Identity: | 51/225 - (22%) |
|---|---|---|---|
| Similarity: | 76/225 - (33%) | Gaps: | 54/225 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 630 LW---GGTVSTLEFRVNVTQEMNGQVYTCQSANEALQRSAHEAVSLDVLYRPKFVPPPSSTAVGV 691
Fly 692 E---------GESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDDAGI 747
Fly 748 YSCSASNSQGGATLNITVVVEYGTTIKSVSENIVVNPGEDAM-LSCTVEGKPLTEEHVKWERVGY 811
Fly 812 DMTVKT-STTFANG----TSYLHIKDAKRE 836 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sns | NP_001036532.1 | I-set | 73..170 | CDD:254352 | |
| Ig | 76..155 | CDD:299845 | |||
| IG_like | 186..279 | CDD:214653 | |||
| Ig | 197..279 | CDD:299845 | |||
| IG_like | 296..376 | CDD:214653 | |||
| Ig | 300..361 | CDD:299845 | |||
| Ig | 380..454 | CDD:299845 | |||
| IG_like | 490..573 | CDD:214653 | |||
| Ig | 501..560 | CDD:299845 | |||
| Ig | 584..666 | CDD:299845 | 10/38 (26%) | ||
| IG_like | 585..666 | CDD:214653 | 10/38 (26%) | ||
| I-set | 678..767 | CDD:254352 | 20/97 (21%) | ||
| IGc2 | 692..757 | CDD:197706 | 14/73 (19%) | ||
| Ig | 788..849 | CDD:143165 | 14/55 (25%) | ||
| Ig | 885..960 | CDD:143165 | |||
| FN3 | 967..1051 | CDD:238020 | |||
| Cd200 | XP_006248387.2 | IgV_1_MRC-OX-2_like | 64..171 | CDD:409433 | 28/136 (21%) |
| Ig strand B | 79..83 | CDD:409433 | 1/13 (8%) | ||
| Ig strand C | 93..97 | CDD:409433 | 1/3 (33%) | ||
| Ig strand E | 136..140 | CDD:409433 | 2/22 (9%) | ||
| Ig strand F | 150..155 | CDD:409433 | 2/4 (50%) | ||
| Ig strand G | 164..167 | CDD:409433 | 0/2 (0%) | ||
| ig | 175..261 | CDD:395002 | 18/71 (25%) | ||
| Ig strand C | 199..205 | CDD:409353 | 0/7 (0%) | ||
| Ig strand C' | 207..209 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 212..220 | CDD:409353 | 2/7 (29%) | ||
| Ig strand E | 225..233 | CDD:409353 | 3/7 (43%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||