DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and Sigirr

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_006536238.2 Gene:Sigirr / 24058 MGIID:1344402 Length:414 Species:Mus musculus


Alignment Length:227 Identity:45/227 - (19%)
Similarity:70/227 - (30%) Gaps:104/227 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 AVQWTKDGFALG----------------FSAVIPGFPRYSVLGDRKQGIYNLRISNASINDDADY 149
            :|||.|||.|||                ||.::             ..:..|.::||  .|...:
Mouse    51 SVQWLKDGLALGNGSHFSLHEDFWVSANFSEIV-------------SSVLVLNLTNA--EDYGTF 100

  Fly   150 QCQV-------------GPARLNSAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQLKCI 201
            .|.|             |||...:|:.|:..:.|:....::                  |.:||.
Mouse   101 TCSVWN
VSSHSFTLWRAGPAGHVAAVLASLLVLVVLLLVAL------------------LYVKCR 147

  Fly   202 VANAKPAAQIVWYRGNVEYKPEKREDT---VEESTAKRFTTTSSLKLKPGPDDDYTEYT-CQARH 262
            :      ..::||           :||   ||.:..|.:             |.|..|: |....
Mouse   148 L------NMLLWY-----------QDTYGEVEMNDGKLY-------------DAYVSYSDCPEDR 182

  Fly   263 K----ALSPDMPMRATVQLSV----LYPPGPP 286
            |    .|.|.:..|...:|.:    |.|...|
Mouse   183 KFVNFILKPQLERRRGYKLFLEDRDLLPRAEP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 22/97 (23%)
Ig 76..155 CDD:299845 17/82 (21%)
IG_like 186..279 CDD:214653 19/100 (19%)
Ig 197..279 CDD:299845 18/89 (20%)
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
SigirrXP_006536238.2 Ig_3 14..106 CDD:372822 17/69 (25%)
TIR 169..331 CDD:366714 12/59 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.