DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and CADM1

DIOPT Version :10

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_016872946.1 Gene:CADM1 / 23705 HGNCID:5951 Length:477 Species:Homo sapiens


Alignment Length:433 Identity:106/433 - (24%)
Similarity:162/433 - (37%) Gaps:117/433 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VLASAPVPSHAQ-------QQKFRTTPHDLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAV 116
            |..|||:...|.       |..|   ..|:.|:||..|.:.|:|.....:|              
Human    32 VQRSAPIAMKASGHTSGDGQNLF---TKDVTVIEGEVATISCQVNKSDDSV-------------- 79

  Fly   117 IPGFPRYSVLGDRKQGIY--------------------NLRIS--NASINDDADYQCQV--GPAR 157
                  ..:|...:|.||                    .|::|  |.||:|:..|.||:  .|.:
Human    80 ------IQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQ 138

  Fly   158 LNSAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQLKCIVANAKPAAQIVWYRGNVEYKP 222
                 .:...:||:.||.::.|    ...|....|.:::::.|....:|||..|.|::||.|.|.
Human   139 -----ESYTTITVLVPPRNLMI----DIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKG 194

  Fly   223 EKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATVQLSVLYPPGPPY 287
            :..   ||| .:..:|.||.|.||...:||.....||..|.|::.::..:.  .|.|.|.|....
Human   195 KSE---VEE-WSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQR--YLEVQYKPQVHI 253

  Fly   288 IEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKNGSQIRMAYRTSGRLSENIYTFTAEAGDNK 352
            ...|......|.|..:||.|.:.|...|..:.|.:...::......||   .|::.......|| 
Human   254 QMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSG---PNLFINNLNKTDN- 314

  Fly   353 ARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVG 417
            ..:||||||::.:  ..::..|.|...||  |:..||          |.||..:           
Human   315 GTYRCEASNIVGK--AHSDYMLYVYDPPT--TIPPPT----------TTTTTTT----------- 354

  Fly   418 GRQVRNATSKTIVSPEGGWTTTSNITAVVEPNKRSLVVICHGL 460
                  .|:.||:      |..::.||..||       ..|||
Human   355 ------TTTTTIL------TIITDTTATTEP-------AVHGL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 Ig 73..170 CDD:472250 23/120 (19%)
Ig strand B 89..93 CDD:409559 1/3 (33%)
Ig strand C 101..105 CDD:409559 1/3 (33%)
Ig strand E 130..138 CDD:409559 4/27 (15%)
Ig strand F 148..153 CDD:409559 2/4 (50%)
Ig 173..279 CDD:472250 31/105 (30%)
Ig strand B 196..200 CDD:409418 0/3 (0%)
Ig strand C 210..214 CDD:409418 1/3 (33%)
Ig strand E 241..245 CDD:409418 2/3 (67%)
Ig strand F 255..260 CDD:409418 1/4 (25%)
Ig strand G 272..275 CDD:409418 0/2 (0%)
Ig_3 285..361 CDD:464046 18/75 (24%)
Ig 377..>457 CDD:472250 16/79 (20%)
Ig strand B 397..401 CDD:409418 0/3 (0%)
Ig strand C 411..415 CDD:409418 0/3 (0%)
Ig strand E 440..444 CDD:409418 0/3 (0%)
Ig 477..560 CDD:472250
Ig strand B 499..504 CDD:409418
Ig strand C 514..518 CDD:409418
Ig strand E 537..541 CDD:409418
Ig strand F 551..556 CDD:409418
Ig 584..666 CDD:472250
Ig strand B 595..599 CDD:409416
Ig strand C 609..613 CDD:409416
Ig strand E 636..642 CDD:409416
Ig strand F 652..657 CDD:409416
Ig strand G 667..670 CDD:409416
Ig 678..767 CDD:472250
Ig strand B 696..700 CDD:409353
Ig strand C 710..714 CDD:409353
Ig strand E 733..737 CDD:409353
Ig strand F 747..752 CDD:409353
Ig_3 772..847 CDD:464046
Ig 881..963 CDD:472250
Ig strand B 885..888 CDD:409353
Ig strand C 897..901 CDD:409353
Ig strand E 929..933 CDD:409353
Ig strand F 943..948 CDD:409353
FN3 967..1051 CDD:238020
CADM1XP_016872946.1 IgV_1_Necl-2 53..146 CDD:409465 23/120 (19%)
FR1 53..71 CDD:409465 6/20 (30%)
Ig strand A 53..55 CDD:409465 1/4 (25%)
Ig strand A' 56..62 CDD:409465 2/5 (40%)
Ig strand B 64..72 CDD:409465 2/7 (29%)
CDR1 72..77 CDD:409465 1/4 (25%)
FR2 78..85 CDD:409465 2/26 (8%)
Ig strand C 78..84 CDD:409465 1/25 (4%)
CDR2 86..97 CDD:409465 3/10 (30%)
Ig strand C' 88..92 CDD:409465 2/3 (67%)
Ig strand C' 94..97 CDD:409465 0/2 (0%)
FR3 98..133 CDD:409465 9/34 (26%)
Ig strand D 102..109 CDD:409465 0/6 (0%)
Ig strand E 112..118 CDD:409465 2/5 (40%)
Ig strand F 125..133 CDD:409465 3/7 (43%)
CDR3 134..137 CDD:409465 0/2 (0%)
Ig strand G 137..146 CDD:409465 0/13 (0%)
FR4 139..146 CDD:409465 0/6 (0%)
IgI_2_Necl-2 147..245 CDD:409466 31/107 (29%)
Ig strand A 147..150 CDD:409466 0/2 (0%)
Ig strand A' 153..157 CDD:409466 1/7 (14%)
Ig strand B 166..176 CDD:409466 1/9 (11%)
Ig strand C 179..188 CDD:409466 4/8 (50%)
Ig strand C' 189..192 CDD:409466 1/2 (50%)
Ig strand D 194..201 CDD:409466 3/10 (30%)
Ig strand E 204..214 CDD:409466 4/9 (44%)
Ig strand F 222..230 CDD:409466 2/7 (29%)
Ig strand G 237..244 CDD:409466 0/8 (0%)
IG_like 258..336 CDD:214653 20/83 (24%)
Ig strand B 269..273 CDD:409353 2/3 (67%)
Ig strand C 282..287 CDD:409353 0/4 (0%)
Ig strand E 301..306 CDD:409353 2/7 (29%)
Ig strand F 316..321 CDD:409353 2/4 (50%)
Ig strand G 329..332 CDD:409353 0/2 (0%)
4.1m 430..448 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.