DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and CADM1

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:XP_016872946.1 Gene:CADM1 / 23705 HGNCID:5951 Length:477 Species:Homo sapiens


Alignment Length:433 Identity:106/433 - (24%)
Similarity:162/433 - (37%) Gaps:117/433 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VLASAPVPSHAQ-------QQKFRTTPHDLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAV 116
            |..|||:...|.       |..|   ..|:.|:||..|.:.|:|.....:|              
Human    32 VQRSAPIAMKASGHTSGDGQNLF---TKDVTVIEGEVATISCQVNKSDDSV-------------- 79

  Fly   117 IPGFPRYSVLGDRKQGIY--------------------NLRIS--NASINDDADYQCQV--GPAR 157
                  ..:|...:|.||                    .|::|  |.||:|:..|.||:  .|.:
Human    80 ------IQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQ 138

  Fly   158 LNSAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQLKCIVANAKPAAQIVWYRGNVEYKP 222
                 .:...:||:.||.::.|    ...|....|.:::::.|....:|||..|.|::||.|.|.
Human   139 -----ESYTTITVLVPPRNLMI----DIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKG 194

  Fly   223 EKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATVQLSVLYPPGPPY 287
            :..   ||| .:..:|.||.|.||...:||.....||..|.|::.::..:.  .|.|.|.|....
Human   195 KSE---VEE-WSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQR--YLEVQYKPQVHI 253

  Fly   288 IEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKNGSQIRMAYRTSGRLSENIYTFTAEAGDNK 352
            ...|......|.|..:||.|.:.|...|..:.|.:...::......||   .|::.......|| 
Human   254 QMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSG---PNLFINNLNKTDN- 314

  Fly   353 ARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVG 417
            ..:||||||::.:  ..::..|.|...||  |:..||          |.||..:           
Human   315 GTYRCEASNIVGK--AHSDYMLYVYDPPT--TIPPPT----------TTTTTTT----------- 354

  Fly   418 GRQVRNATSKTIVSPEGGWTTTSNITAVVEPNKRSLVVICHGL 460
                  .|:.||:      |..::.||..||       ..|||
Human   355 ------TTTTTIL------TIITDTTATTEP-------AVHGL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352 23/120 (19%)
Ig 76..155 CDD:299845 21/102 (21%)
IG_like 186..279 CDD:214653 28/92 (30%)
Ig 197..279 CDD:299845 26/81 (32%)
IG_like 296..376 CDD:214653 20/79 (25%)
Ig 300..361 CDD:299845 16/60 (27%)
Ig 380..454 CDD:299845 16/73 (22%)
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
CADM1XP_016872946.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11787
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.