DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and F830045P16Rik

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_808321.1 Gene:F830045P16Rik / 228592 MGIID:3045317 Length:487 Species:Mus musculus


Alignment Length:443 Identity:99/443 - (22%)
Similarity:155/443 - (34%) Gaps:111/443 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 WYRGNVEYKPEKREDTVEEST------AKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPM 271
            |.|.|.|: |......|..:.      :|.:.|.:.       .|..::.||:..|..|..  |:
Mouse    70 WLRNNNEH-PASTTHVVHVNNDSYSLRSKAWVTLTK-------QDISSQITCEVTHGDLKE--PL 124

  Fly   272 RATVQLSVLYPPGP--------PYIEGYSAGETLRRGQTVELMCRSRGGNPP-AQLIWYKNGSQI 327
            |.|:.||.:....|        |.|:.:.       .|.|.|.|......|. ..|||.|||.:|
Mouse   125 RMTINLSQVLRVIP
TLKITTEDPEIQDHV-------HQKVNLTCHVNHFYPQNMDLIWTKNGHKI 182

  Fly   328 -RMAYRTSGRLSENIY----TFTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMG 387
             .|....:.|.|:..|    |...:|..||..|.|.... ..|.|:|..:.|.   ||.  .:.|
Mouse   183 PTMELPQTTRNSDGTYSLQHTLQVDAILNKTDFVCWV
IQ-DDQPPVKNSITLG---APR--KIRG 241

  Fly   388 PTEARVGDIVPLTCTTAPSNPPAEIKWMVGGRQVRNATSKTIVSPEGGWTTTSNITAVVEPNKRS 452
            .||.......||  ...|.....::|:.....|.|..|...:.:......|.:|:.:..|     
Mouse   242 RTEYSHHLEGPL--QRFPPGASIQLKYTSSALQTRQVTVTWLKNNHTRLQTQTNVFSNGE----- 299

  Fly   453 LVVICHGLNMQLTENVVSTHTINVLYPPAPPLISGYME-------------GQII---PAGSVQK 501
                        |.||.||..:::.......|:...:|             ||.:   ||..|.:
Mouse   300 ------------TYNVTSTAIVSLESDDILSLVLCLVEHKSLVVFQKVIYLGQYLCVPPAVRVSQ 352

  Fly   502 LLCVSSGGNPLATLT-----WYKNDKRIN-----SVIRAADKSVSAEITILANVSDNQAQYRCEA 556
            ...|||    |.|:|     :|..:..::     .|||..::.....        :....|..| 
Mouse   353 SSTVSS----LVTVTCHVQRFYPQEVYLSWLEDCHVIRRIEQPTPKR--------NEDGSYTLE- 404

  Fly   557 SNSATEIPLFQSTTLSVHFAPETVKIRIEPEELRPGMEATIICDSSSSNPPAK 609
                    :.|....||..:.:.:..::|.|| .|.::|:|:. |::|.|.:|
Mouse   405 --------VLQLVNTSVERSDQVLTCKVEHEE-HPPIQASIVL-SAASFPTSK 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653 17/71 (24%)
Ig 197..279 CDD:299845 17/71 (24%)
IG_like 296..376 CDD:214653 26/85 (31%)
Ig 300..361 CDD:299845 22/66 (33%)
Ig 380..454 CDD:299845 14/73 (19%)
IG_like 490..573 CDD:214653 19/108 (18%)
Ig 501..560 CDD:299845 12/68 (18%)
Ig 584..666 CDD:299845 10/26 (38%)
IG_like 585..666 CDD:214653 10/25 (40%)
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
F830045P16RikNP_808321.1 Ig 34..138 CDD:299845 18/77 (23%)
IgC 147..219 CDD:143166 24/78 (31%)
Ig 251..346 CDD:299845 19/113 (17%)
IgC 348..436 CDD:143166 21/109 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.