Sequence 1: | NP_001036532.1 | Gene: | sns / 44097 | FlyBaseID: | FBgn0024189 | Length: | 1542 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157990.1 | Gene: | Iglon5 / 210094 | MGIID: | 2686277 | Length: | 336 | Species: | Mus musculus |
Alignment Length: | 328 | Identity: | 83/328 - (25%) |
---|---|---|---|
Similarity: | 130/328 - (39%) | Gaps: | 58/328 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 684 PSSTAVGVEGESLQVSL-----QTRA---NPTPVTY----KWTKDG-----TTIPQDGDHRIFAD 731
Fly 732 GGSLNFTRLHRDDAGIYSCSASNSQGGATLNITVVVEYGTTIKSVSENIVVNPGEDAMLSCTVEG 796
Fly 797 KPLTEEHVKWERVGYDMTVKTSTTFANGTSYLHIKDAKREDVGNFRCVADNRVDN-PTNRDILLI 860
Fly 861 VKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSL 925
Fly 926 TYESTLIVDKVAPADYGAYECVARNELGEAVETVR------LEITSQPDPPLSLNILNVTHDTVT 984
Fly 985 LAW 987 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sns | NP_001036532.1 | I-set | 73..170 | CDD:254352 | |
Ig | 76..155 | CDD:299845 | |||
IG_like | 186..279 | CDD:214653 | |||
Ig | 197..279 | CDD:299845 | |||
IG_like | 296..376 | CDD:214653 | |||
Ig | 300..361 | CDD:299845 | |||
Ig | 380..454 | CDD:299845 | |||
IG_like | 490..573 | CDD:214653 | |||
Ig | 501..560 | CDD:299845 | |||
Ig | 584..666 | CDD:299845 | |||
IG_like | 585..666 | CDD:214653 | |||
I-set | 678..767 | CDD:254352 | 20/99 (20%) | ||
IGc2 | 692..757 | CDD:197706 | 18/81 (22%) | ||
Ig | 788..849 | CDD:143165 | 16/60 (27%) | ||
Ig | 885..960 | CDD:143165 | 21/74 (28%) | ||
FN3 | 967..1051 | CDD:238020 | 7/21 (33%) | ||
Iglon5 | NP_001157990.1 | Ig | 41..129 | CDD:416386 | 19/96 (20%) |
Ig strand A' | 41..46 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 48..56 | CDD:409353 | 1/7 (14%) | ||
CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
FR2 | 61..68 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 61..67 | CDD:409353 | 2/5 (40%) | ||
CDR2 | 69..79 | CDD:409353 | 1/9 (11%) | ||
Ig strand C' | 71..74 | CDD:409353 | 0/2 (0%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
FR3 | 80..115 | CDD:409353 | 10/43 (23%) | ||
Ig strand D | 84..91 | CDD:409353 | 0/6 (0%) | ||
Ig strand E | 94..100 | CDD:409353 | 1/14 (7%) | ||
Ig strand F | 107..115 | CDD:409353 | 4/7 (57%) | ||
CDR3 | 116..120 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 120..129 | CDD:409353 | 1/8 (13%) | ||
FR4 | 122..129 | CDD:409353 | 1/6 (17%) | ||
Ig strand A | 132..137 | CDD:409353 | 1/4 (25%) | ||
Ig_3 | 134..199 | CDD:404760 | 20/74 (27%) | ||
Ig strand A' | 140..145 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 148..157 | CDD:409353 | 2/8 (25%) | ||
Ig strand C | 163..167 | CDD:409353 | 1/3 (33%) | ||
Ig strand D | 174..177 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand F | 191..199 | CDD:409353 | 3/7 (43%) | ||
Ig_3 | 217..295 | CDD:404760 | 22/85 (26%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 234..238 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 247..251 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |