| Sequence 1: | NP_001036532.1 | Gene: | sns / 44097 | FlyBaseID: | FBgn0024189 | Length: | 1542 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_660339.1 | Gene: | CADM4 / 199731 | HGNCID: | 30825 | Length: | 388 | Species: | Homo sapiens |
| Alignment Length: | 301 | Identity: | 87/301 - (28%) |
|---|---|---|---|
| Similarity: | 136/301 - (45%) | Gaps: | 42/301 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 547 DNQAQYRCEASNSATEIPLFQSTTLSVHFAPETVKIRIEPEELRPGMEATIICDSSSSNPPAKLS 611
Fly 612 WWKDGIPIEGINNTSKPGLWGGTVSTLEFRVNVTQEMNGQVYTCQSANEALQRSAHEAVS---LD 673
Fly 674 VLYRPKFVPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFT 738
Fly 739 RLHRDDAGIYSCSASNSQGGA-TLNITVVVEYGTTIK---SVSENIV-------------VNPGE 786
Fly 787 DAMLSCTV--EGKPLTEEHVKWERVGYDMTVKTSTTFANGT 825 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sns | NP_001036532.1 | I-set | 73..170 | CDD:254352 | |
| Ig | 76..155 | CDD:299845 | |||
| IG_like | 186..279 | CDD:214653 | |||
| Ig | 197..279 | CDD:299845 | |||
| IG_like | 296..376 | CDD:214653 | |||
| Ig | 300..361 | CDD:299845 | |||
| Ig | 380..454 | CDD:299845 | |||
| IG_like | 490..573 | CDD:214653 | 7/25 (28%) | ||
| Ig | 501..560 | CDD:299845 | 2/12 (17%) | ||
| Ig | 584..666 | CDD:299845 | 22/81 (27%) | ||
| IG_like | 585..666 | CDD:214653 | 22/80 (28%) | ||
| I-set | 678..767 | CDD:254352 | 28/89 (31%) | ||
| IGc2 | 692..757 | CDD:197706 | 20/64 (31%) | ||
| Ig | 788..849 | CDD:143165 | 12/40 (30%) | ||
| Ig | 885..960 | CDD:143165 | |||
| FN3 | 967..1051 | CDD:238020 | |||
| CADM4 | NP_660339.1 | Ig | 29..120 | CDD:416386 | 7/25 (28%) |
| FR1 | 29..45 | CDD:409353 | |||
| Ig strand A' | 30..36 | CDD:409353 | |||
| Ig strand B | 38..46 | CDD:409353 | |||
| CDR1 | 46..51 | CDD:409353 | |||
| FR2 | 52..59 | CDD:409353 | |||
| Ig strand C | 52..58 | CDD:409353 | |||
| CDR2 | 60..71 | CDD:409353 | |||
| Ig strand C' | 62..66 | CDD:409353 | |||
| Ig strand C' | 68..71 | CDD:409353 | |||
| FR3 | 72..107 | CDD:409353 | 2/12 (17%) | ||
| Ig strand D | 76..83 | CDD:409353 | |||
| Ig strand E | 86..92 | CDD:409353 | |||
| Ig strand F | 99..107 | CDD:409353 | 2/10 (20%) | ||
| CDR3 | 108..111 | CDD:409353 | 2/2 (100%) | ||
| Ig strand G | 111..120 | CDD:409353 | 3/8 (38%) | ||
| FR4 | 113..120 | CDD:409353 | 3/6 (50%) | ||
| IgI_2_Necl-4 | 121..220 | CDD:409468 | 28/102 (27%) | ||
| Ig strand B | 141..145 | CDD:409468 | 0/3 (0%) | ||
| Ig strand C | 155..159 | CDD:409468 | 1/3 (33%) | ||
| Ig strand E | 182..186 | CDD:409468 | 2/3 (67%) | ||
| Ig strand F | 196..201 | CDD:409468 | 1/4 (25%) | ||
| Ig strand G | 213..216 | CDD:409468 | 0/2 (0%) | ||
| Ig_3 | 224..295 | CDD:404760 | 22/75 (29%) | ||
| Ig strand A' | 231..235 | CDD:409353 | 2/3 (67%) | ||
| Ig strand B | 241..248 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 255..260 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 262..264 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 274..280 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 287..294 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 300..308 | CDD:409353 | 2/7 (29%) | ||
| 4.1m | 344..362 | CDD:128590 | 7/22 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 49 | 1.000 | Domainoid score | I11787 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||