DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and Il1rap

DIOPT Version :9

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001152790.1 Gene:Il1rap / 16180 MGIID:104975 Length:685 Species:Mus musculus


Alignment Length:688 Identity:133/688 - (19%)
Similarity:218/688 - (31%) Gaps:223/688 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   515 LTWYKNDKRINSVIR--AADKSVSAEITILANV---SDNQAQYRCEASNSATEIPLFQSTTLSVH 574
            |.||........:::  |:::.....:..:..:   .|..|:.:|         |||:      |
Mouse     3 LLWYLMSLSFYGILQSHASERCDDWGLDTMRQIQVFEDEPARIKC---------PLFE------H 52

  Fly   575 FAPETVKIRIEPEELRPGMEATIICDSSSSNPPAKLSWW---KDGIPIEGIN--------NTSKP 628
            |.....                    |::.:....|.|:   :|....|.||        :..|.
Mouse    53 FLKYNY--------------------STAHSSGLTLIWYWTRQDRDLEEPINFRLPENRISKEKD 97

  Fly   629 GLWGGTVSTLEFRVNVTQEMNGQVYTCQSAN-----------EALQRSA--HEAVSLDV--LYRP 678
            .||        ||..:..:...  |||...|           |.:|:.:  :.|:...|  :|..
Mouse    98 VLW--------FRPTLLNDTGN--YTCMLRNTTYCSKVAFPLEVVQKDSCFNSAMRFPVHKMYIE 152

  Fly   679 KFVPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRD 743
            ..:  ...|...|:|     ...:...|:...||    |.|...| .|.:..:|.:|:|......
Mouse   153 HGI--HKITCPNVDG-----YFPSSVKPSVTWYK----GCTEIVD-FHNVLPEGMNLSFFIPLVS 205

  Fly   744 DAGIYSCSASNSQGGATLNITVVVEYGTTIK--------------SVSENIVV--NPGEDAMLSC 792
            :.|.|:|..:..:.|...::|..|    |:|              |.::.:|.  .|||:.::.|
Mouse   206 NNGNYTCVVTYPENGRLFHLTRTV----TVKVVGSPKDALPPQIYSPNDRVVYEKEPGEELVIPC 266

  Fly   793 TVEGKPLTEEH--VKW-------ERVGYDMTVKTSTTFAN-----GTSYLHIKDAKREDV-GNFR 842
            .|....:.:.|  |.|       :.|..|:|:..|.::::     .|..|.||....||: .|:.
Mouse   267 KVYFSFIMDSHNEVWWTIDGKKPDDVTVDITINESVSYSSTEDETRTQILSIKKVTPEDLRRNYV 331

  Fly   843 CVADNRVDN------------PTNRDILLIVKFAPEIAKTPTLL--------------RAASGTG 881
            |.|.|....            |....:.|...|...:.....|:              ||..||.
Mouse   332 CHARNTKGEAEQAAKVKQKVIPPRYTVELACGFGATVFLVVVLIVVYHVYWLEMVLFYRAHFGTD 396

  Fly   882 ERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYEC 946
            |.                 ..|.|:..|..:|...|||.:...||....|      ..::|...|
Mouse   397 ET-----------------ILDGKEYDIYVSYARNVEEEEFVLLTLRGVL------ENEFGYKLC 438

  Fly   947 V-ARNEL--GEAVETV--------RLEITSQPDPPLSLNILNVTHDTVTLAWTPGFDGGLKASYR 1000
            : .|:.|  |..||.|        |:.:...||        .||..::::.   .|..|:.....
Mouse   439 IFDRDSLPGGNTVEAVFDFIQRSRRMIVVLSPD--------YVTEKSISML---EFKLGVMCQNS 492

  Fly  1001 -------VRYR---------MADREQYKYID--GLPNSH------KLTIGGLRMNTLYLFSVMSW 1041
                   |.||         |..:|...::.  |..:.|      |.....|.:.:|...|  .|
Mouse   493 IATKLIVVEYRPLEQPHPGIMQLKESVSFVSWKGEKSKHSGSKFWKALRLALPLRSLSASS--GW 555

  Fly  1042 NELGQSS---YLPDLARAETKEAPPPSHPASSLGGGPP 1076
            ||...|.   .|..:.|....:.||....:..:.|..|
Mouse   556 NESCSSQSDISLDHVQRRSRLKEPPELRSSERVSGAEP 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653 10/62 (16%)
Ig 501..560 CDD:299845 7/49 (14%)
Ig 584..666 CDD:299845 18/103 (17%)
IG_like 585..666 CDD:214653 18/102 (18%)
I-set 678..767 CDD:254352 18/88 (20%)
IGc2 692..757 CDD:197706 14/64 (22%)
Ig 788..849 CDD:143165 19/75 (25%)
Ig 885..960 CDD:143165 18/85 (21%)
FN3 967..1051 CDD:238020 21/110 (19%)
Il1rapNP_001152790.1 Ig1_IL1R_like 25..132 CDD:409584 25/151 (17%)
Ig strand B 43..47 CDD:409584 1/3 (33%)
Ig strand C 67..71 CDD:409584 1/3 (33%)
Ig strand E 97..101 CDD:409584 2/11 (18%)
Ig strand F 111..116 CDD:409584 3/6 (50%)
Ig strand G 124..127 CDD:409584 0/2 (0%)
Ig 145..235 CDD:416386 23/105 (22%)
Ig strand A 145..150 CDD:409353 1/4 (25%)
Ig strand A 145..150 CDD:409353 1/4 (25%)
Ig strand B 156..160 CDD:409353 0/3 (0%)
Ig strand B 156..160 CDD:409353 0/3 (0%)
Ig strand C 174..179 CDD:409353 0/4 (0%)
Ig strand C 174..179 CDD:409353 0/4 (0%)
Ig strand C' 182..184 CDD:409353 1/1 (100%)
Ig strand C' 182..184 CDD:409353 1/1 (100%)
Ig strand D 189..193 CDD:409353 0/3 (0%)
Ig strand D 189..193 CDD:409353 0/3 (0%)
Ig strand E 195..200 CDD:409353 1/4 (25%)
Ig strand E 195..200 CDD:409353 1/4 (25%)
Ig strand F 209..218 CDD:409353 2/8 (25%)
Ig strand F 209..218 CDD:409353 2/8 (25%)
Ig strand G 221..234 CDD:409353 4/16 (25%)
Ig strand G 221..234 CDD:409353 4/16 (25%)
Ig3_IL1RAP 243..349 CDD:409525 24/105 (23%)
Ig strand B 262..266 CDD:409525 0/3 (0%)
Ig strand C 279..283 CDD:409525 1/3 (33%)
Ig strand E 314..318 CDD:409525 1/3 (33%)
Ig strand F 329..334 CDD:409525 2/4 (50%)
Ig strand G 341..344 CDD:409525 0/2 (0%)
TIR 404..547 CDD:214587 32/159 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.